Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3489
Gene name Gene Name - the full gene name approved by the HGNC.
Insulin like growth factor binding protein 6
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
IGFBP6
Synonyms (NCBI Gene) Gene synonyms aliases
IBP6
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12q13.13
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT2429972 hsa-miR-145 CLIP-seq
MIRT2429973 hsa-miR-1825 CLIP-seq
MIRT2429974 hsa-miR-199a-5p CLIP-seq
MIRT2429975 hsa-miR-199b-5p CLIP-seq
MIRT2429976 hsa-miR-3667-3p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001968 Function Fibronectin binding IBA
GO:0005102 Function Signaling receptor binding TAS 24431302
GO:0005515 Function Protein binding IPI 24003225, 32296183
GO:0005520 Function Insulin-like growth factor binding IEA
GO:0005576 Component Extracellular region IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
146735 5475 ENSG00000167779
Protein
UniProt ID P24592
Protein name Insulin-like growth factor-binding protein 6 (IBP-6) (IGF-binding protein 6) (IGFBP-6)
Protein function IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. Activates t
PDB 1RMJ , 2JM2
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00086 Thyroglobulin_1 163 234 Thyroglobulin type-1 repeat Domain
Sequence
MTPHRLLPPLLLLLALLLAASPGGALARCPGCGQGVQAGCPGGCVEEEDGGSPAEGCAEA
EGCLRREGQECGVYTPNCAPGLQCHPPKDDEAPLRALLLGRGRCLPARAPAVAEENPKES
KPQAGTARPQDVNRRDQQRNPGTSTTPSQPNSAGVQDTEMGPCRRHLDSVLQQLQTEVYR
GAQTLYVPNCDHRGFYRKRQCRSSQGQRRGPCWCVDRMGKSLPGSPDGNGSSSC
PTGSSG
Sequence length 240
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Diabetes Type 2 diabetes N/A N/A GWAS
Oligodendroglioma Oligodendroglioma N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Acute Kidney Injury Associate 37396184
Anemia Sickle Cell Associate 38353026
Arthritis Rheumatoid Associate 27141097
Bipolar Disorder Associate 38303428
Bone Marrow Diseases Associate 34905501
Breast Neoplasms Associate 18957410, 37950222, 38235137
Breast Neoplasms Inhibit 39275851
Carcinoma Hepatocellular Associate 21548981
Carcinoma Non Small Cell Lung Associate 31545451
Carcinoma Renal Cell Associate 15086466