Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3489
Gene name	Insulin like growth factor binding protein 6
Gene symbol	IGFBP6
Synonyms (NCBI Gene)	IBP6
Chromosome	12
Chromosome location	12q13.13

Show/Hide all (55)

miRTarBase ID	miRNA	Experiments
MIRT2429972	hsa-miR-145	CLIP-seq
MIRT2429973	hsa-miR-1825	CLIP-seq
MIRT2429974	hsa-miR-199a-5p	CLIP-seq
MIRT2429975	hsa-miR-199b-5p	CLIP-seq
MIRT2429976	hsa-miR-3667-3p	CLIP-seq
MIRT2429977	hsa-miR-4326	CLIP-seq
MIRT2429978	hsa-miR-4716-5p	CLIP-seq
MIRT2437781	hsa-miR-3124-3p	CLIP-seq
MIRT2437782	hsa-miR-3591-3p	CLIP-seq
MIRT2550587	hsa-miR-129-5p	CLIP-seq
MIRT2550588	hsa-miR-1908	CLIP-seq
MIRT2550589	hsa-miR-2277-3p	CLIP-seq
MIRT2550590	hsa-miR-2861	CLIP-seq
MIRT2437781	hsa-miR-3124-3p	CLIP-seq
MIRT2550591	hsa-miR-3165	CLIP-seq
MIRT2550592	hsa-miR-3180	CLIP-seq
MIRT2550593	hsa-miR-3180-3p	CLIP-seq
MIRT2550594	hsa-miR-3184	CLIP-seq
MIRT2550595	hsa-miR-3196	CLIP-seq
MIRT2437782	hsa-miR-3591-3p	CLIP-seq
MIRT2550596	hsa-miR-3616-3p	CLIP-seq
MIRT2550597	hsa-miR-3675-5p	CLIP-seq
MIRT2550598	hsa-miR-423-5p	CLIP-seq
MIRT2550599	hsa-miR-4512	CLIP-seq
MIRT2550600	hsa-miR-4641	CLIP-seq
MIRT2550601	hsa-miR-4658	CLIP-seq
MIRT2550602	hsa-miR-4710	CLIP-seq
MIRT2550603	hsa-miR-4721	CLIP-seq
MIRT2550604	hsa-miR-4758-5p	CLIP-seq
MIRT2550605	hsa-miR-4765	CLIP-seq
MIRT2550606	hsa-miR-493	CLIP-seq
MIRT2550607	hsa-miR-653	CLIP-seq
MIRT2550608	hsa-miR-663	CLIP-seq
MIRT2550609	hsa-miR-744	CLIP-seq
MIRT2550588	hsa-miR-1908	CLIP-seq
MIRT2550589	hsa-miR-2277-3p	CLIP-seq
MIRT2550590	hsa-miR-2861	CLIP-seq
MIRT2437781	hsa-miR-3124-3p	CLIP-seq
MIRT2550591	hsa-miR-3165	CLIP-seq
MIRT2550592	hsa-miR-3180	CLIP-seq
MIRT2550593	hsa-miR-3180-3p	CLIP-seq
MIRT2550594	hsa-miR-3184	CLIP-seq
MIRT2550595	hsa-miR-3196	CLIP-seq
MIRT2437782	hsa-miR-3591-3p	CLIP-seq
MIRT2550596	hsa-miR-3616-3p	CLIP-seq
MIRT2550597	hsa-miR-3675-5p	CLIP-seq
MIRT2550598	hsa-miR-423-5p	CLIP-seq
MIRT2429977	hsa-miR-4326	CLIP-seq
MIRT2550600	hsa-miR-4641	CLIP-seq
MIRT2550602	hsa-miR-4710	CLIP-seq
MIRT2429978	hsa-miR-4716-5p	CLIP-seq
MIRT2550603	hsa-miR-4721	CLIP-seq
MIRT2550606	hsa-miR-493	CLIP-seq
MIRT2550608	hsa-miR-663	CLIP-seq
MIRT2550609	hsa-miR-744	CLIP-seq

Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001968	Function	Fibronectin binding	IBA
GO:0005102	Function	Signaling receptor binding	TAS	24431302
GO:0005515	Function	Protein binding	IPI	24003225, 32296183
GO:0005520	Function	Insulin-like growth factor binding	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0007165	Process	Signal transduction	NAS	10087296
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	7539002
GO:0016477	Process	Cell migration	IDA	24003225
GO:0019838	Function	Growth factor binding	IEA
GO:0031994	Function	Insulin-like growth factor I binding	IBA
GO:0031994	Function	Insulin-like growth factor I binding	IEA
GO:0031995	Function	Insulin-like growth factor II binding	IBA
GO:0031995	Function	Insulin-like growth factor II binding	IEA
GO:0031995	Function	Insulin-like growth factor II binding	IMP	15308688
GO:0032874	Process	Positive regulation of stress-activated MAPK cascade	IDA	24003225
GO:0042568	Component	Insulin-like growth factor binary complex	IMP	15308688
GO:0042802	Function	Identical protein binding	IPI	32296183
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	24003225
GO:0043567	Process	Regulation of insulin-like growth factor receptor signaling pathway	IBA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	TAS	24431302

MIM	HGNC	e!Ensembl
146735	5475	ENSG00000167779

P24592

Protein name

Insulin-like growth factor-binding protein 6 (IBP-6) (IGF-binding protein 6) (IGFBP-6)

Protein function

IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. Activates t

PDB

1RMJ , 2JM2

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00086	Thyroglobulin_1	163 → 234	Thyroglobulin type-1 repeat	Domain

Sequence

MTPHRLLPPLLLLLALLLAASPGGALARCPGCGQGVQAGCPGGCVEEEDGGSPAEGCAEA
EGCLRREGQECGVYTPNCAPGLQCHPPKDDEAPLRALLLGRGRCLPARAPAVAEENPKES
KPQAGTARPQDVNRRDQQRNPGTSTTPSQPNSAGVQDTEMGPCRRHLDSVLQQLQTEVYR
GAQTLYVPNCDHRGFYRKRQCRSSQGQRRGPCWCVDRMGKSLPGSPDGNGSSSCPTGSSG

Sequence length

240

Interactions

View interactions

	Reactome
			Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Cervical cancer	Benign	rs9658617	RCV005910663
Clear cell carcinoma of kidney	Benign	rs9658617	RCV005910664
Gastric cancer	Benign	rs9658617	RCV005910665
Ovarian serous cystadenocarcinoma	Benign	rs9658617	RCV005910666
Thymoma	Benign	rs9658617	RCV005910667
Thyroid cancer, nonmedullary, 1	Benign	rs9658617	RCV005910668
Uterine corpus endometrial carcinoma	Benign	rs9658617	RCV005910669

Show/Hide Text Mining Associations (49)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Acute Kidney Injury	Associate	37396184
Anemia Sickle Cell	Associate	38353026
Arthritis Rheumatoid	Associate	27141097
Bipolar Disorder	Associate	38303428
Bone Marrow Diseases	Associate	34905501
Breast Neoplasms	Associate	18957410, 37950222, 38235137
Breast Neoplasms	Inhibit	39275851
Carcinoma Hepatocellular	Associate	21548981
Carcinoma Non Small Cell Lung	Associate	31545451
Carcinoma Renal Cell	Associate	15086466
Carcinoma Squamous Cell	Inhibit	21819702
Carotid Artery Diseases	Associate	32037372
Carotid Stenosis	Inhibit	32037372
Colorectal Neoplasms	Associate	17519236, 23748022, 27644646, 29439316
Colorectal Neoplasms	Inhibit	37088808
Diabetes Mellitus	Inhibit	26976474
Diabetes Mellitus	Associate	35230239
Diabetes Mellitus Type 2	Inhibit	39275851
Diabetic Nephropathies	Associate	37396184
Endometrial Neoplasms	Associate	23167388
Fatty Liver	Associate	33125080
Glioblastoma	Associate	35832140, 36193073
Glioma	Associate	27650075, 34396926, 40428295
Graves Ophthalmopathy	Associate	33153489
HIV Infections	Inhibit	26039376
Hypertension Pulmonary	Associate	38353026
Immunoglobulin G4 Related Disease	Associate	17519236
Inflammation	Associate	34396926
Mental Disorders	Associate	32093803
Metabolic Syndrome	Associate	27644646, 35230239
Multiple Myeloma	Associate	10192430
Neoplasm Metastasis	Associate	27644646
Neoplasms	Associate	17519236, 21548981, 26976474, 27644646, 34396926, 39275851
Neoplasms	Inhibit	24003225, 27650075, 29039467
Neoplasms	Stimulate	34905501
Neoplasms Germ Cell and Embryonal	Associate	9536279
Obesity	Associate	34371941
Ovarian Neoplasms	Associate	33282953
Peripheral Nervous System Neoplasms	Inhibit	16443732
Polycystic Ovary Syndrome	Stimulate	20452586
Primary Myelofibrosis	Associate	34905501
Prostatic Neoplasms	Associate	15846301
Rhabdomyosarcoma	Associate	24003225
Schizophrenia	Associate	32093803
Seminoma	Associate	15967097
Stomach Neoplasms	Inhibit	37088808
Stroke	Associate	36315566
Urinary Bladder Neoplasms	Associate	28882129
Uterine Cervical Neoplasms	Associate	39372720

IGFBP6 (insulin like growth factor binding protein 6)