Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3488
Gene name Gene Name - the full gene name approved by the HGNC.
Insulin like growth factor binding protein 5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
IGFBP5
Synonyms (NCBI Gene) Gene synonyms aliases
IBP5
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q35
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT006556 hsa-miR-140-5p qRT-PCR 19948051
MIRT050836 hsa-miR-17-5p CLASH 23622248
MIRT043414 hsa-miR-331-3p CLASH 23622248
MIRT054449 hsa-miR-211-5p Luciferase reporter assay, Microarray, qRT-PCR, Western blot 24039954
MIRT724856 hsa-miR-1264 HITS-CLIP 19536157
Transcription factors
Transcription factor Regulation Reference
ETV6 Activation 17242174
TFAP2A Activation 7559606
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001558 Process Regulation of cell growth IEA
GO:0001649 Process Osteoblast differentiation IEA
GO:0001968 Function Fibronectin binding IBA 21873635
GO:0005515 Function Protein binding IPI 15700281, 25910212, 31515488, 32296183
GO:0005576 Component Extracellular region NAS 14718574
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
146734 5474 ENSG00000115461
Protein
UniProt ID P24593
Protein name Insulin-like growth factor-binding protein 5 (IBP-5) (IGF-binding protein 5) (IGFBP-5)
Protein function Multifunctional protein that plays a critical role in regulating the availability of IGFs to their receptors and thereby regulates IGF-mediated cellular processes including proliferation, differentiation, and apoptosis in a cell-type specific ma
PDB 1BOE , 1H59 , 7UFG
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00219 IGFBP 27 80 Insulin-like growth factor binding protein Domain
PF00086 Thyroglobulin_1 192 263 Thyroglobulin type-1 repeat Domain
Tissue specificity TISSUE SPECIFICITY: Osteosarcoma, and at lower levels in liver, kidney and brain.
Sequence
MVLLTAVLLLLAAYAGPAQSLGSFVHCEPCDEKALSMCPPSPLGCELVKEPGCGCCMTCA
LAEGQSCGVYTERCAQGLRC
LPRQDEEKPLHALLHGRGVCLNEKSYREQVKIERDSREHE
EPTTSEMAEETYSPKIFRPKHTRISELKAEAVKKDRRKKLTQSKFVGGAENTAHPRIISA
PEMRQESEQGPCRRHMEASLQELKASPRMVPRAVYLPNCDRKGFYKRKQCKPSRGRKRGI
CWCVDKYGMKLPGMEYVDGDFQC
HTFDSSNVE
Sequence length 272
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
Post-translational protein phosphorylation
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Breast cancer Malignant neoplasm of breast rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158
View all (309 more)
20354179
Breast carcinoma Breast Carcinoma rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451
View all (71 more)
20354179
Marfan syndrome Mammary Carcinoma, Human rs137854456, rs137854457, rs267606796, rs137854458, rs137854459, rs137854460, rs137854470, rs137854471, rs267606797, rs137854461, rs137854462, rs137854463, rs869025419, rs137854464, rs137854465
View all (942 more)
20354179
Associations from Text Mining
Disease Name Relationship Type References
Adenomyosis Associate 36532077
Arthritis Psoriatic Associate 27706699
Arthritis Rheumatoid Associate 28775366, 31210318
Atherosclerosis Associate 17804819, 39337683
Brain Concussion Inhibit 34675105
Breast Neoplasms Associate 10811646, 17121430, 17651454, 18210156, 19341485, 22287600, 24157812, 25248036, 25422220, 26515727, 27050076, 27402876, 27612043, 27835577, 31311202
View all (1 more)
Cancer Pain Associate 28911071
Carcinogenesis Associate 32801999
Carcinoma Associate 16729015
Carcinoma in Situ Associate 9536279