Gene Gene information from NCBI Gene database.
Entrez ID 3488
Gene name Insulin like growth factor binding protein 5
Gene symbol IGFBP5
Synonyms (NCBI Gene)
IBP5
Chromosome 2
Chromosome location 2q35
miRNA miRNA information provided by mirtarbase database.
2765
miRTarBase ID miRNA Experiments Reference
MIRT006556 hsa-miR-140-5p qRT-PCR 19948051
MIRT050836 hsa-miR-17-5p CLASH 23622248
MIRT043414 hsa-miR-331-3p CLASH 23622248
MIRT054449 hsa-miR-211-5p Luciferase reporter assayMicroarrayqRT-PCRWestern blot 24039954
MIRT724856 hsa-miR-1264 HITS-CLIP 19536157
Transcription factors Transcription factors information provided by TRRUST V2 database.
2
Transcription factor Regulation Reference
ETV6 Activation 17242174
TFAP2A Activation 7559606
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
55
GO ID Ontology Definition Evidence Reference
GO:0001558 Process Regulation of cell growth IEA
GO:0001649 Process Osteoblast differentiation IEA
GO:0001968 Function Fibronectin binding IBA
GO:0001968 Function Fibronectin binding IEA
GO:0005515 Function Protein binding IPI 15700281, 25910212, 31515488, 32296183
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
146734 5474 ENSG00000115461
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P24593
Protein name Insulin-like growth factor-binding protein 5 (IBP-5) (IGF-binding protein 5) (IGFBP-5)
Protein function Multifunctional protein that plays a critical role in regulating the availability of IGFs to their receptors and thereby regulates IGF-mediated cellular processes including proliferation, differentiation, and apoptosis in a cell-type specific ma
PDB 1BOE , 1H59 , 7UFG
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00219 IGFBP 27 80 Insulin-like growth factor binding protein Domain
PF00086 Thyroglobulin_1 192 263 Thyroglobulin type-1 repeat Domain
Tissue specificity TISSUE SPECIFICITY: Osteosarcoma, and at lower levels in liver, kidney and brain.
Sequence
MVLLTAVLLLLAAYAGPAQSLGSFVHCEPCDEKALSMCPPSPLGCELVKEPGCGCCMTCA
LAEGQSCGVYTERCAQGLRC
LPRQDEEKPLHALLHGRGVCLNEKSYREQVKIERDSREHE
EPTTSEMAEETYSPKIFRPKHTRISELKAEAVKKDRRKKLTQSKFVGGAENTAHPRIISA
PEMRQESEQGPCRRHMEASLQELKASPRMVPRAVYLPNCDRKGFYKRKQCKPSRGRKRGI
CWCVDKYGMKLPGMEYVDGDFQC
HTFDSSNVE
Sequence length 272
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
Post-translational protein phosphorylation
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
EBV-positive nodal T- and NK-cell lymphoma Likely benign rs765651866 RCV004560323
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenomyosis Associate 36532077
Arthritis Psoriatic Associate 27706699
Arthritis Rheumatoid Associate 28775366, 31210318
Atherosclerosis Associate 17804819, 39337683
Brain Concussion Inhibit 34675105
Breast Neoplasms Associate 10811646, 17121430, 17651454, 18210156, 19341485, 22287600, 24157812, 25248036, 25422220, 26515727, 27050076, 27402876, 27612043, 27835577, 31311202
View all (1 more)
Cancer Pain Associate 28911071
Carcinogenesis Associate 32801999
Carcinoma Associate 16729015
Carcinoma in Situ Associate 9536279