Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3486
Gene name Gene Name - the full gene name approved by the HGNC.
Insulin like growth factor binding protein 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
IGFBP3
Synonyms (NCBI Gene) Gene synonyms aliases
BP-53, IBP-3, IBP3, IGFBP-3
Chromosome Chromosome number
7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7p12.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein forms a ternary complex with insulin-like growth factor acid-labile subunit (I
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT019713 hsa-miR-375 Microarray 20215506
MIRT022363 hsa-miR-124-3p Microarray 18668037
MIRT054206 hsa-miR-210-3p Luciferase reporter assay, Microarray, qRT-PCR, Western blot 23028679
MIRT702750 hsa-miR-5580-3p HITS-CLIP 23313552
MIRT702749 hsa-miR-4773 HITS-CLIP 23313552
Transcription factors
Transcription factor Regulation Reference
AR Unknown 23859805
CDX2 Repression 17297462
DLX5 Unknown 17278996
DNMT3A Repression 19070387
EP300 Activation 12200149
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000165 Process MAPK cascade IEA
GO:0001558 Process Regulation of cell growth IEA
GO:0001649 Process Osteoblast differentiation IEA
GO:0001933 Process Negative regulation of protein phosphorylation IDA 17591901
GO:0001968 Function Fibronectin binding IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
146732 5472 ENSG00000146674
Protein
UniProt ID P17936
Protein name Insulin-like growth factor-binding protein 3 (IBP-3) (IGF-binding protein 3) (IGFBP-3)
Protein function Multifunctional protein that plays a critical role in regulating the availability of IGFs such as IGF1 and IGF2 to their receptors and thereby regulates IGF-mediated cellular processes including proliferation, differentiation, and apoptosis in a
PDB 7WRQ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00219 IGFBP 40 94 Insulin-like growth factor binding protein Domain
PF00086 Thyroglobulin_1 213 285 Thyroglobulin type-1 repeat Domain
Tissue specificity TISSUE SPECIFICITY: Expressed by most tissues. Present in plasma.
Sequence
MQRARPTLWAAALTLLVLLRGPPVARAGASSAGLGPVVRCEPCDARALAQCAPPPAVCAE
LVREPGCGCCLTCALSEGQPCGIYTERCGSGLRC
QPSPDEARPLQALLDGRGLCVNASAV
SRLRAYLLPAPPAPGNASESEEDRSAGSVESPSVSSTHRVSDPKFHPLHSKIIIIKKGHA
KDSQRYKVDYESQSTDTQNFSSESKRETEYGPCRREMEDTLNHLKFLNVLSPRGVHIPNC
DKKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPGYTTKGKEDVHC
YSMQSK
Sequence length 291
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  p53 signaling pathway
Cellular senescence
Growth hormone synthesis, secretion and action
Transcriptional misregulation in cancer
  Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
TP53 Regulates Transcription of Death Receptors and Ligands
Post-translational protein phosphorylation
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Atrial Fibrillation Atrial fibrillation N/A N/A GWAS
Mental Depression Major depressive disorder N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Abnormalities Drug Induced Associate 21278247, 27370225
Achondroplasia Associate 27370225
Acromegaly Stimulate 27070751
Acromegaly Associate 30290787
Adenocarcinoma Associate 21254935, 30335898, 36133437
Adenocarcinoma Inhibit 30335898
Adenocarcinoma of Lung Associate 27610375, 30815935, 31085806, 34996932, 35860262
Adenoma Associate 18498652
Adenoma Islet Cell Associate 28900071
Aging Premature Associate 35069971