Gene Gene information from NCBI Gene database.
Entrez ID 3486
Gene name Insulin like growth factor binding protein 3
Gene symbol IGFBP3
Synonyms (NCBI Gene)
BP-53IBP-3IBP3IGFBP-3
Chromosome 7
Chromosome location 7p12.3
Summary This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein forms a ternary complex with insulin-like growth factor acid-labile subunit (I
miRNA miRNA information provided by mirtarbase database.
568
miRTarBase ID miRNA Experiments Reference
MIRT019713 hsa-miR-375 Microarray 20215506
MIRT022363 hsa-miR-124-3p Microarray 18668037
MIRT054206 hsa-miR-210-3p Luciferase reporter assayMicroarrayqRT-PCRWestern blot 23028679
MIRT702750 hsa-miR-5580-3p HITS-CLIP 23313552
MIRT702749 hsa-miR-4773 HITS-CLIP 23313552
Transcription factors Transcription factors information provided by TRRUST V2 database.
15
Transcription factor Regulation Reference
AR Unknown 23859805
CDX2 Repression 17297462
DLX5 Unknown 17278996
DNMT3A Repression 19070387
EP300 Activation 12200149
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
44
GO ID Ontology Definition Evidence Reference
GO:0000165 Process MAPK cascade IEA
GO:0001558 Process Regulation of cell growth IEA
GO:0001649 Process Osteoblast differentiation IEA
GO:0001933 Process Negative regulation of protein phosphorylation IDA 17591901
GO:0001968 Function Fibronectin binding IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
146732 5472 ENSG00000146674
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P17936
Protein name Insulin-like growth factor-binding protein 3 (IBP-3) (IGF-binding protein 3) (IGFBP-3)
Protein function Multifunctional protein that plays a critical role in regulating the availability of IGFs such as IGF1 and IGF2 to their receptors and thereby regulates IGF-mediated cellular processes including proliferation, differentiation, and apoptosis in a
PDB 7WRQ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00219 IGFBP 40 94 Insulin-like growth factor binding protein Domain
PF00086 Thyroglobulin_1 213 285 Thyroglobulin type-1 repeat Domain
Tissue specificity TISSUE SPECIFICITY: Expressed by most tissues. Present in plasma.
Sequence
MQRARPTLWAAALTLLVLLRGPPVARAGASSAGLGPVVRCEPCDARALAQCAPPPAVCAE
LVREPGCGCCLTCALSEGQPCGIYTERCGSGLRC
QPSPDEARPLQALLDGRGLCVNASAV
SRLRAYLLPAPPAPGNASESEEDRSAGSVESPSVSSTHRVSDPKFHPLHSKIIIIKKGHA
KDSQRYKVDYESQSTDTQNFSSESKRETEYGPCRREMEDTLNHLKFLNVLSPRGVHIPNC
DKKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPGYTTKGKEDVHC
YSMQSK
Sequence length 291
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  p53 signaling pathway
Cellular senescence
Growth hormone synthesis, secretion and action
Transcriptional misregulation in cancer
  Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
TP53 Regulates Transcription of Death Receptors and Ligands
Post-translational protein phosphorylation