IGFBP2 (insulin like growth factor binding protein 2)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3485
Gene name Gene Name - the full gene name approved by the HGNC.
Insulin like growth factor binding protein 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
IGFBP2
Synonyms (NCBI Gene) Gene synonyms aliases
IBP2, IGF-BP53
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q35
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is one of six similar proteins that bind insulin-like growth factors I and II (IGF-I and IGF-II). The encoded protein can be secreted into the bloodstream, where it binds IGF-I and IGF-II with high affinity, or it can rema
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(27)
miRTarBase ID miRNA Experiments Reference
MIRT006543 hsa-miR-126-3p ELISA, Flow, Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot 22170610
MIRT006543 hsa-miR-126-3p ELISA, Flow, Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot 22170610
MIRT006543 hsa-miR-126-3p ELISA, Flow, Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot 22170610
MIRT017411 hsa-miR-335-5p Microarray 18185580
MIRT732358 hsa-miR-204-5p Immunoblot, Luciferase reporter assay, Microarray, qRT-PCR 27487563
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(32)
GO ID Ontology Definition Evidence Reference
GO:0005102 Function Signaling receptor binding TAS 24431302
GO:0005515 Function Protein binding IPI 19095771
GO:0005576 Component Extracellular region ISS
GO:0005576 Component Extracellular region TAS
GO:0005615 Component Extracellular space IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
146731 5471 ENSG00000115457
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID P18065
Protein name Insulin-like growth factor-binding protein 2 (IBP-2) (IGF-binding protein 2) (IGFBP-2)
Protein function Multifunctional protein that plays a critical role in regulating the availability of IGFs such as IGF1 and IGF2 to their receptors and thereby regulates IGF-mediated cellular processes including proliferation, differentiation, and apoptosis in a
PDB 2H7T
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00219 IGFBP 42 → 111 Insulin-like growth factor binding protein Domain
PF00086 Thyroglobulin_1 227 → 306 Thyroglobulin type-1 repeat Domain
Sequence 
MLPRVGCPALPLPPPPLLPLLLLLLGASGGGGGARAEVLFRCPPCTPERLAACGPPPVAP
PAAVAAVAGGARMPCAELVREPGCGCCSVCARLEGEACGVYTPRCGQGLRCYPHPGSELP
LQALVMGEGTCEKRRDAEYGASPEQVADNGDDHSEGGLVENHVDSTMNMLGGGGSAGRKP
LKSGMKELAVFREKVTEQHRQMGKGGKHHLGLEEPKKLRPPPARTPCQQELDQVLERIST
MRLPDERGPLEHLYSLHIPNCDKHGLYNLKQCKMSLNGQRGECWCVNPNTGKLIQGAPTI
RGDPECHLFYNEQQEARGVHTQRMQ
Sequence length 325
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (3)
Causal
Disease term Disease name dbSNP ID References
Adenocarcinoma Adenoid Cystic Carcinoma rs121913530, rs886039394, rs121913474 16762588
Dermatitis Contact Dermatitis rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174 25724174
Obesity Obesity rs74315349, rs1474810899, rs121918111, rs796065034, rs753856820, rs796065035, rs121918112, rs104894023, rs137852821, rs1580764441, rs137852822, rs137852823, rs137852824, rs13447324, rs121913562
View all (27 more)		 22537059
Show/Hide Unknown Diseases (1)
Unknown
Disease term Disease name Evidence References Source
Strabismus Strabismus GWAS
Show/Hide Text Mining Associations (144)
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma Stimulate 24069370
Adenocarcinoma Associate 26317790, 30626422, 31545451
Adenocarcinoma of Lung Associate 20150439, 37784035
Adrenal Cortex Neoplasms Associate 17280861
Adrenocortical Carcinoma Associate 17280861
Alzheimer Disease Associate 22801742, 28968233, 34459398
Astrocytoma Associate 18952587, 22547392
Atrial Fibrillation Associate 32682418, 34737791
Biliary Atresia Associate 12808327
Bipolar Disorder Inhibit 28090803