IGFBP2 (insulin like growth factor binding protein 2)

Gene

• Entrez ID: 3485
• Gene name: Insulin like growth factor binding protein 2
• Gene symbol: IGFBP2
• Synonyms (NCBI Gene): IBP2, IGF-BP53
• Chromosome: 2
• Chromosome location: 2q35
• Summary: The protein encoded by this gene is one of six similar proteins that bind insulin-like growth factors I and II (IGF-I and IGF-II). The encoded protein can be secreted into the bloodstream, where it binds IGF-I and IGF-II with high affinity, or it can rema

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT006543	hsa-miR-126-3p	ELISA, Flow, Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	22170610
MIRT006543	hsa-miR-126-3p	ELISA, Flow, Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	22170610
MIRT006543	hsa-miR-126-3p	ELISA, Flow, Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	22170610
MIRT017411	hsa-miR-335-5p	Microarray	18185580
MIRT732358	hsa-miR-204-5p	Immunoblot, Luciferase reporter assay, Microarray, qRT-PCR	27487563
MIRT732358	hsa-miR-204-5p	Immunoblot, Luciferase reporter assay, Microarray, qRT-PCR	27487563
MIRT1549915	hsa-miR-1250	CLIP-seq
MIRT1549916	hsa-miR-138	CLIP-seq
MIRT1549917	hsa-miR-3124-3p	CLIP-seq
MIRT1549918	hsa-miR-3148	CLIP-seq
MIRT1549919	hsa-miR-3663-5p	CLIP-seq
MIRT1549920	hsa-miR-4668-3p	CLIP-seq
MIRT1549921	hsa-miR-4753-3p	CLIP-seq
MIRT1549922	hsa-miR-592	CLIP-seq
MIRT1549923	hsa-miR-597	CLIP-seq
MIRT1549924	hsa-miR-875-3p	CLIP-seq
MIRT2014664	hsa-miR-3065-3p	CLIP-seq
MIRT1549918	hsa-miR-3148	CLIP-seq
MIRT2014665	hsa-miR-338-3p	CLIP-seq
MIRT2014666	hsa-miR-3667-3p	CLIP-seq
MIRT2014667	hsa-miR-4530	CLIP-seq
MIRT2014668	hsa-miR-4640-3p	CLIP-seq
MIRT1549920	hsa-miR-4668-3p	CLIP-seq
MIRT2014669	hsa-miR-4691-5p	CLIP-seq
MIRT1549921	hsa-miR-4753-3p	CLIP-seq
MIRT2014670	hsa-miR-766	CLIP-seq
MIRT1549924	hsa-miR-875-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001649	Process	Osteoblast differentiation	IDA	22869525
GO:0001649	Process	Osteoblast differentiation	IDA	26773517
GO:0004864	Function	Protein phosphatase inhibitor activity	IDA	22869525
GO:0005102	Function	Signaling receptor binding	TAS	24431302
GO:0005515	Function	Protein binding	IPI	19095771
GO:0005520	Function	Insulin-like growth factor binding	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	ISS
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	22869525
GO:0005615	Component	Extracellular space	IDA	15694994
GO:0005615	Component	Extracellular space	IEA
GO:0007565	Process	Female pregnancy	IEA
GO:0007584	Process	Response to nutrient	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009612	Process	Response to mechanical stimulus	IEA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0019838	Function	Growth factor binding	IEA
GO:0030547	Function	Signaling receptor inhibitor activity	IDA	22869525
GO:0031994	Function	Insulin-like growth factor I binding	IBA
GO:0031994	Function	Insulin-like growth factor I binding	IDA	19081843
GO:0031994	Function	Insulin-like growth factor I binding	IEA
GO:0031995	Function	Insulin-like growth factor II binding	IBA
GO:0031995	Function	Insulin-like growth factor II binding	IEA
GO:0031995	Function	Insulin-like growth factor II binding	ISS
GO:0032355	Process	Response to estradiol	IEA
GO:0032526	Process	Response to retinoic acid	IEA
GO:0032870	Process	Cellular response to hormone stimulus	IEA
GO:0042104	Process	Positive regulation of activated T cell proliferation	IDA	15694994
GO:0043567	Process	Regulation of insulin-like growth factor receptor signaling pathway	IBA
GO:0043567	Process	Regulation of insulin-like growth factor receptor signaling pathway	IC	19081843
GO:0043567	Process	Regulation of insulin-like growth factor receptor signaling pathway	ISS
GO:0043627	Process	Response to estrogen	IEA
GO:0045668	Process	Negative regulation of osteoblast differentiation	IDA	22869525
GO:0048545	Process	Response to steroid hormone	IEA
GO:0051384	Process	Response to glucocorticoid	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IEA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	TAS	24431302
GO:0141069	Function	Receptor ligand inhibitor activity	IDA	22869525

Other IDs

• MIM: 146731
• HGNC: 5471
• e!Ensembl: ENSG00000115457

Protein

• UniProt ID: P18065
• Protein name: Insulin-like growth factor-binding protein 2 (IBP-2) (IGF-binding protein 2) (IGFBP-2)
• Protein function: Multifunctional protein that plays a critical role in regulating the availability of IGFs such as IGF1 and IGF2 to their receptors and thereby regulates IGF-mediated cellular processes including proliferation, differentiation, and apoptosis in a
• PDB: 2H7T
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00219	IGFBP	42 → 111	Insulin-like growth factor binding protein	Domain
  PF00086	Thyroglobulin_1	227 → 306	Thyroglobulin type-1 repeat	Domain

• Sequence:

  MLPRVGCPALPLPPPPLLPLLLLLLGASGGGGGARAEVLFRCPPCTPERLAACGPPPVAP
  PAAVAAVAGGARMPCAELVREPGCGCCSVCARLEGEACGVYTPRCGQGLRCYPHPGSELP
  LQALVMGEGTCEKRRDAEYGASPEQVADNGDDHSEGGLVENHVDSTMNMLGGGGSAGRKP
  LKSGMKELAVFREKVTEQHRQMGKGGKHHLGLEEPKKLRPPPARTPCQQELDQVLERIST
  MRLPDERGPLEHLYSLHIPNCDKHGLYNLKQCKMSLNGQRGECWCVNPNTGKLIQGAPTI
  RGDPECHLFYNEQQEARGVHTQRMQ

• Sequence length: 325

Pathways

Reactome:

Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)