Gene Gene information from NCBI Gene database.
Entrez ID 3481
Gene name Insulin like growth factor 2
Gene symbol IGF2
Synonyms (NCBI Gene)
C11orf43GRDFIGF-IIPP9974SRS3
Chromosome 11
Chromosome location 11p15.5
Summary This gene encodes a member of the insulin family of polypeptide growth factors, which are involved in development and growth. It is an imprinted gene, expressed only from the paternal allele, and epigenetic changes at this locus are associated with Wilms
miRNA miRNA information provided by mirtarbase database.
811
miRTarBase ID miRNA Experiments Reference
MIRT004520 hsa-let-7a-5p Luciferase reporter assay 17974952
MIRT005738 hsa-miR-125b-5p Luciferase reporter assayNorthern blotWestern blot 21200031
MIRT005738 hsa-miR-125b-5p Luciferase reporter assayNorthern blotWestern blot 21200031
MIRT005739 hsa-miR-150-5p Luciferase reporter assay 21200031
MIRT005739 hsa-miR-150-5p Luciferase reporter assay 21200031
Transcription factors Transcription factors information provided by TRRUST V2 database.
18
Transcription factor Regulation Reference
ASCL1 Repression 20842449
CEBPA Unknown 7659086
CTCF Unknown 18458536;20966046;21536749;24725430
DDX5 Unknown 20966046
EGR1 Activation 8634146
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
71
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II ISS
GO:0001503 Process Ossification IEA
GO:0001649 Process Osteoblast differentiation IEA
GO:0001701 Process In utero embryonic development IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
147470 5466 ENSG00000167244
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P01344
Protein name Insulin-like growth factor 2 (Insulin-like growth factor II) (IGF-II) (Somatomedin-A) (T3M-11-derived growth factor) [Cleaved into: Insulin-like growth factor II Ala-25 Del; Preptin]
Protein function The insulin-like growth factors possess growth-promoting activity (By similarity). Major fetal growth hormone in mammals. Plays a key role in regulating fetoplacental development. IGF2 is influenced by placental lactogen. Also involved in tissue
PDB 1IGL , 2L29 , 2V5P , 3E4Z , 3KR3 , 5L3L , 5L3M , 5L3N , 6UM2 , 6VWG , 6VWI , 8U4C , 8U4E , 8VJB , 8VJC
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00049 Insulin 30 62 Insulin/IGF/Relaxin family Domain
PF00049 Insulin 54 84 Insulin/IGF/Relaxin family Domain
PF08365 IGF2_C 112 166 Insulin-like growth factor II E-peptide Family
Tissue specificity TISSUE SPECIFICITY: Expressed in heart, placenta, lung, liver, muscle, kidney, tongue, limb, eye and pancreas. {ECO:0000269|PubMed:16531418}.
Sequence
MGIPMGKSMLVLLTFLAFASCCIAAYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVS
RR
SRGIVEECCFRSCDLALLETYC
ATPAKSERDVSTPPTVLPDNFPRYPVGKFFQYDTWK
QSTQRLRRGLPALLRARRGHVLAKELEAFREAKRHRPLIALPTQDP
AHGGAPPEMASNRK
Sequence length 180
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  MAPK signaling pathway
Ras signaling pathway
Hormone signaling
PI3K-Akt signaling pathway
Pathways in cancer
Proteoglycans in cancer
Hepatocellular carcinoma
  Platelet degranulation
Signaling by Type 1 Insulin-like Growth Factor 1 Receptor (IGF1R)
IRS-related events triggered by IGF1R
SHC-related events triggered by IGF1R
Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
52
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Beckwith-Wiedemann syndrome Likely pathogenic rs1858937359 RCV002491857
Colorectal cancer Pathogenic rs1858717597 RCV001293830
IGF2-related disorder Pathogenic rs2495589617 RCV003394389
See cases Likely pathogenic; Pathogenic rs2495590055 RCV003156171
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
EBV-positive nodal T- and NK-cell lymphoma Likely benign rs762038895 RCV004560322
INSULIN-LIKE GROWTH FACTOR II POLYMORPHISM Benign rs3842759, rs3741211, rs79275529 RCV000015869
RCV000015870
RCV000015871
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Abortion Habitual Associate 23583422, 37699152
Abortion Spontaneous Associate 20484977
Adenocarcinoma Associate 22159423
Adenocarcinoma of Lung Associate 33228740, 35974000, 8276819
Adenoma Associate 20682317, 25110432, 30578081
Adenoma Islet Cell Associate 18552458, 26666605, 36742395, 7685912
Adenoma Islet Cell Stimulate 30520387
Adenomyosis Associate 17296180
Adrenal Cortex Neoplasms Associate 23028800, 31378849, 33650791
Adrenal Gland Neoplasms Associate 26400872