Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	347902
Gene name	Adhesion molecule with Ig like domain 2
Gene symbol	AMIGO2
Synonyms (NCBI Gene)	ALI1AMIGO-2DEGA
Chromosome	12
Chromosome location	12q13.11

165

Show/Hide all (165)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001573	hsa-miR-155-5p	pSILAC	18668040
MIRT001573	hsa-miR-155-5p	Proteomics;Other	18668040
MIRT022417	hsa-miR-124-3p	Microarray	18668037
MIRT779825	hsa-miR-1265	CLIP-seq
MIRT779826	hsa-miR-1272	CLIP-seq
MIRT779827	hsa-miR-1322	CLIP-seq
MIRT779828	hsa-miR-183	CLIP-seq
MIRT779829	hsa-miR-2392	CLIP-seq
MIRT779830	hsa-miR-3065-5p	CLIP-seq
MIRT779831	hsa-miR-3591-3p	CLIP-seq
MIRT779832	hsa-miR-3913-3p	CLIP-seq
MIRT779833	hsa-miR-425	CLIP-seq
MIRT779834	hsa-miR-4517	CLIP-seq
MIRT779835	hsa-miR-4764-5p	CLIP-seq
MIRT779836	hsa-miR-485-3p	CLIP-seq
MIRT779837	hsa-miR-487a	CLIP-seq
MIRT779838	hsa-miR-489	CLIP-seq
MIRT779827	hsa-miR-1322	CLIP-seq
MIRT779839	hsa-miR-224	CLIP-seq
MIRT779840	hsa-miR-2861	CLIP-seq
MIRT779841	hsa-miR-3121-3p	CLIP-seq
MIRT779842	hsa-miR-3614-3p	CLIP-seq
MIRT779843	hsa-miR-3658	CLIP-seq
MIRT779844	hsa-miR-3664-5p	CLIP-seq
MIRT779845	hsa-miR-3682-3p	CLIP-seq
MIRT779846	hsa-miR-4297	CLIP-seq
MIRT779847	hsa-miR-4307	CLIP-seq
MIRT779848	hsa-miR-4473	CLIP-seq
MIRT779849	hsa-miR-4662a-3p	CLIP-seq
MIRT779850	hsa-miR-4662a-5p	CLIP-seq
MIRT779851	hsa-miR-4699-3p	CLIP-seq
MIRT779852	hsa-miR-4714-5p	CLIP-seq
MIRT779853	hsa-miR-4731-3p	CLIP-seq
MIRT779854	hsa-miR-4766-5p	CLIP-seq
MIRT779855	hsa-miR-4773	CLIP-seq
MIRT779856	hsa-miR-4789-5p	CLIP-seq
MIRT779857	hsa-miR-4801	CLIP-seq
MIRT779858	hsa-miR-512-3p	CLIP-seq
MIRT779859	hsa-miR-520f	CLIP-seq
MIRT1930148	hsa-miR-101	CLIP-seq
MIRT1930149	hsa-miR-105	CLIP-seq
MIRT1930150	hsa-miR-1182	CLIP-seq
MIRT1930151	hsa-miR-1224-5p	CLIP-seq
MIRT779826	hsa-miR-1272	CLIP-seq
MIRT1930152	hsa-miR-1298	CLIP-seq
MIRT1930153	hsa-miR-1305	CLIP-seq
MIRT779827	hsa-miR-1322	CLIP-seq
MIRT1930154	hsa-miR-1324	CLIP-seq
MIRT1930155	hsa-miR-144	CLIP-seq
MIRT779828	hsa-miR-183	CLIP-seq
MIRT779839	hsa-miR-224	CLIP-seq
MIRT779840	hsa-miR-2861	CLIP-seq
MIRT779830	hsa-miR-3065-5p	CLIP-seq
MIRT1930156	hsa-miR-3117-5p	CLIP-seq
MIRT1930157	hsa-miR-3123	CLIP-seq
MIRT1930158	hsa-miR-3166	CLIP-seq
MIRT1930159	hsa-miR-323-3p	CLIP-seq
MIRT1930160	hsa-miR-323b-5p	CLIP-seq
MIRT1930161	hsa-miR-330-3p	CLIP-seq
MIRT779842	hsa-miR-3614-3p	CLIP-seq
MIRT1930162	hsa-miR-3653	CLIP-seq
MIRT779843	hsa-miR-3658	CLIP-seq
MIRT1930163	hsa-miR-3663-5p	CLIP-seq
MIRT779844	hsa-miR-3664-5p	CLIP-seq
MIRT1930164	hsa-miR-3671	CLIP-seq
MIRT1930165	hsa-miR-3678-3p	CLIP-seq
MIRT779845	hsa-miR-3682-3p	CLIP-seq
MIRT1930166	hsa-miR-3685	CLIP-seq
MIRT1930167	hsa-miR-384	CLIP-seq
MIRT1930168	hsa-miR-3915	CLIP-seq
MIRT1930169	hsa-miR-3928	CLIP-seq
MIRT779846	hsa-miR-4297	CLIP-seq
MIRT779848	hsa-miR-4473	CLIP-seq
MIRT1930170	hsa-miR-450b-5p	CLIP-seq
MIRT779834	hsa-miR-4517	CLIP-seq
MIRT779849	hsa-miR-4662a-3p	CLIP-seq
MIRT1930171	hsa-miR-4670-3p	CLIP-seq
MIRT1930172	hsa-miR-4689	CLIP-seq
MIRT779851	hsa-miR-4699-3p	CLIP-seq
MIRT779852	hsa-miR-4714-5p	CLIP-seq
MIRT779853	hsa-miR-4731-3p	CLIP-seq
MIRT1930173	hsa-miR-4760-3p	CLIP-seq
MIRT779854	hsa-miR-4766-5p	CLIP-seq
MIRT1930174	hsa-miR-4771	CLIP-seq
MIRT779855	hsa-miR-4773	CLIP-seq
MIRT1930175	hsa-miR-4777-3p	CLIP-seq
MIRT779856	hsa-miR-4789-5p	CLIP-seq
MIRT779857	hsa-miR-4801	CLIP-seq
MIRT1930176	hsa-miR-507	CLIP-seq
MIRT1930177	hsa-miR-510	CLIP-seq
MIRT779858	hsa-miR-512-3p	CLIP-seq
MIRT1930178	hsa-miR-512-5p	CLIP-seq
MIRT1930179	hsa-miR-513a-3p	CLIP-seq
MIRT1930180	hsa-miR-514	CLIP-seq
MIRT1930181	hsa-miR-514b-3p	CLIP-seq
MIRT779859	hsa-miR-520f	CLIP-seq
MIRT1930182	hsa-miR-548ad	CLIP-seq
MIRT1930183	hsa-miR-553	CLIP-seq
MIRT1930184	hsa-miR-557	CLIP-seq
MIRT1930185	hsa-miR-601	CLIP-seq
MIRT1930186	hsa-miR-607	CLIP-seq
MIRT1930187	hsa-miR-659	CLIP-seq
MIRT1930188	hsa-miR-664	CLIP-seq
MIRT779827	hsa-miR-1322	CLIP-seq
MIRT779842	hsa-miR-3614-3p	CLIP-seq
MIRT779845	hsa-miR-3682-3p	CLIP-seq
MIRT779846	hsa-miR-4297	CLIP-seq
MIRT779842	hsa-miR-3614-3p	CLIP-seq
MIRT779846	hsa-miR-4297	CLIP-seq
MIRT1930151	hsa-miR-1224-5p	CLIP-seq
MIRT779826	hsa-miR-1272	CLIP-seq
MIRT1930153	hsa-miR-1305	CLIP-seq
MIRT779827	hsa-miR-1322	CLIP-seq
MIRT1930154	hsa-miR-1324	CLIP-seq
MIRT779828	hsa-miR-183	CLIP-seq
MIRT779830	hsa-miR-3065-5p	CLIP-seq
MIRT1930156	hsa-miR-3117-5p	CLIP-seq
MIRT1930157	hsa-miR-3123	CLIP-seq
MIRT1930160	hsa-miR-323b-5p	CLIP-seq
MIRT779843	hsa-miR-3658	CLIP-seq
MIRT1930166	hsa-miR-3685	CLIP-seq
MIRT1930167	hsa-miR-384	CLIP-seq
MIRT1930168	hsa-miR-3915	CLIP-seq
MIRT1930169	hsa-miR-3928	CLIP-seq
MIRT1930172	hsa-miR-4689	CLIP-seq
MIRT2473494	hsa-miR-4747-5p	CLIP-seq
MIRT1930175	hsa-miR-4777-3p	CLIP-seq
MIRT1930179	hsa-miR-513a-3p	CLIP-seq
MIRT1930180	hsa-miR-514	CLIP-seq
MIRT1930181	hsa-miR-514b-3p	CLIP-seq
MIRT1930186	hsa-miR-607	CLIP-seq
MIRT1930187	hsa-miR-659	CLIP-seq
MIRT1930151	hsa-miR-1224-5p	CLIP-seq
MIRT779826	hsa-miR-1272	CLIP-seq
MIRT1930153	hsa-miR-1305	CLIP-seq
MIRT779827	hsa-miR-1322	CLIP-seq
MIRT1930154	hsa-miR-1324	CLIP-seq
MIRT779828	hsa-miR-183	CLIP-seq
MIRT779830	hsa-miR-3065-5p	CLIP-seq
MIRT1930156	hsa-miR-3117-5p	CLIP-seq
MIRT1930157	hsa-miR-3123	CLIP-seq
MIRT2674951	hsa-miR-3133	CLIP-seq
MIRT2674952	hsa-miR-3150a-3p	CLIP-seq
MIRT2674953	hsa-miR-3175	CLIP-seq
MIRT1930160	hsa-miR-323b-5p	CLIP-seq
MIRT2674954	hsa-miR-3646	CLIP-seq
MIRT779843	hsa-miR-3658	CLIP-seq
MIRT2674955	hsa-miR-3662	CLIP-seq
MIRT2674956	hsa-miR-3675-5p	CLIP-seq
MIRT1930166	hsa-miR-3685	CLIP-seq
MIRT1930167	hsa-miR-384	CLIP-seq
MIRT1930168	hsa-miR-3915	CLIP-seq
MIRT1930169	hsa-miR-3928	CLIP-seq
MIRT2674957	hsa-miR-4470	CLIP-seq
MIRT1930172	hsa-miR-4689	CLIP-seq
MIRT2674958	hsa-miR-4698	CLIP-seq
MIRT2674959	hsa-miR-4742-5p	CLIP-seq
MIRT2473494	hsa-miR-4747-5p	CLIP-seq
MIRT1930175	hsa-miR-4777-3p	CLIP-seq
MIRT1930179	hsa-miR-513a-3p	CLIP-seq
MIRT1930180	hsa-miR-514	CLIP-seq
MIRT1930181	hsa-miR-514b-3p	CLIP-seq
MIRT1930186	hsa-miR-607	CLIP-seq
MIRT1930187	hsa-miR-659	CLIP-seq
MIRT2674960	hsa-miR-939	CLIP-seq

Show/Hide all (13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	21078624, 32296183
GO:0005634	Component	Nucleus	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0007155	Process	Cell adhesion	IEA
GO:0007156	Process	Homophilic cell adhesion via plasma membrane adhesion molecules	ISS	12629050
GO:0007157	Process	Heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	IBA
GO:0007157	Process	Heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	ISS	12629050
GO:0007420	Process	Brain development	IBA
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0043069	Process	Negative regulation of programmed cell death	ISS	12843293
GO:0051965	Process	Positive regulation of synapse assembly	IBA
GO:0051965	Process	Positive regulation of synapse assembly	IEA

MIM	HGNC	e!Ensembl
615690	24073	ENSG00000139211

Q86SJ2

Protein name

Amphoterin-induced protein 2 (AMIGO-2) (Alivin-1) (Differentially expressed in gastric adenocarcinomas) (DEGA)

Protein function

Required for depolarization-dependent survival of cultured cerebellar granule neurons. May mediate homophilic as well as heterophilic cell-cell interaction with AMIGO1 or AMIGO3. May contribute to signal transduction through its intracellular do

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13855	LRR_8	93 → 153	Leucine rich repeat	Repeat
PF13855	LRR_8	117 → 177	Leucine rich repeat	Repeat
PF13855	LRR_8	141 → 204	Leucine rich repeat	Repeat
PF00047	ig	298 → 371	Immunoglobulin domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Highest levels in breast, ovary, cervix, and uterus. Lower levels in lung, colon, and rectum. Differentially expressed in 56% of thyroid, 57% of pancreatic and 45% of stomach cancers. {ECO:0000269|PubMed:15107827}.

Sequence

MSLRVHTLPTLLGAVVRPGCRELLCLLMITVTVGPGASGVCPTACICATDIVSCTNKNLS
KVPGNLFRLIKRLDLSYNRIGLLDSEWIPVSFAKLNTLILRHNNITSISTGSFSTTPNLK
CLDLSSNKLKTVKNAVFQELKVLEVLLLYNNHISYLDPSAFGGLSQLQKLYLSGNFLTQF
PMDLYVGRFKLAELMFLDVSYNRIPSMPMHHINLVPGKQLRGIYLHGNPFVCDCSLYSLL
VFWYRRHFSSVMDFKNDYTCRLWSDSRHSRQVLLLQDSFMNCSDSIINGSFRALGFIHEA
QVGERLMVHCDSKTGNANTDFIWVGPDNRLLEPDKEMENFYVFHNGSLVIESPRFEDAGV
YSCIAMNKQRLLNETVDVTINVSNFTVSRSHAHEAFNTAFTTLAACVASIVLVLLYLYLT
PCPCKCKTKRQKNMLHQSNAHSSILSPGPASDASADERKAGAGKRVVFLEPLKDTAAGQN
GKVRLFPSEAVIAEGILKSTRGKSDSDSVNSVFSDTPFVAST

Sequence length

522

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CRANIOFACIAL MICROSOMIA	—	GenCC	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOLDENHAR SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (16)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma	Associate	35296279	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Stimulate	38432455	★★★★★ ★☆☆☆☆ Found in Text Mining only
Auriculoosteodysplasia	Associate	33530447	★★★★★ ★☆☆☆☆ Found in Text Mining only
Calcinosis Cutis	Associate	29149598	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Associate	37438979	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	29182684, 35039535	★★★★★ ★☆☆☆☆ Found in Text Mining only
Infarction Middle Cerebral Artery	Associate	37270727	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Associate	29149598, 34218270, 34296805	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	22078224, 35296279	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Stimulate	35039535	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	33908609, 35039535, 35296279, 37438979	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroinflammatory Diseases	Associate	37270727	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Associate	28611293	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondylocostal dysostosis autosomal recessive	Associate	33530447	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Associate	35039535	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	35039535, 35296279	★★★★★ ★☆☆☆☆ Found in Text Mining only

AMIGO2 (adhesion molecule with Ig like domain 2)