GATD1 (glutamine amidotransferase class 1 domain containing 1)

Gene Gene information from NCBI Gene database.
Gene Gene ontology Other IDs Protein
Entrez ID 347862
Gene name Glutamine amidotransferase class 1 domain containing 1
Gene symbol GATD1
Synonyms (NCBI Gene)
FERRY5Fy-5PDDC1
Chromosome 11
Chromosome location 11p15.5
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8
Gene Gene ontology Other IDs Protein
Show/Hide all (8)
GO ID Ontology Definition Evidence Reference
GO:0005576 Component Extracellular region IEA
GO:0005737 Component Cytoplasm IBA
GO:0005768 Component Endosome IEA
GO:0005769 Component Early endosome IEA
GO:0019172 Function Glyoxalase III activity IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Gene Gene ontology Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8NB37
Protein name Glutamine amidotransferase-like class 1 domain-containing protein 1 (Ferry endosomal RAB5 effector complex subunit 5) (Fy-5) (Parkinson disease 7 domain-containing protein 1)
Protein function Component of the FERRY complex (Five-subunit Endosomal Rab5 and RNA/ribosome intermediary) (PubMed:37267905, PubMed:37267906). The FERRY complex directly interacts with mRNAs and RAB5A, and functions as a RAB5A effector involved in the localizat
PDB 7ND2 , 8A3P
Family and domains
Sequence 
MASERLPNRPACLLVASGAAEGVSAQSFLHCFTMASTAFNLQVATPGGKAMEFVDVTESN
ARWVQDFRLKAYASPAKLESIDGARYHALLIPSCPGALTDLASSGSLARILQHFHSESKP
ICAVGHGVAALCCATNEDRSWVFDSYSLTGPSVCELVRAPGFARLPLVVEDFVKDSGACF
SASEPDAVHVVLDRHLVTGQNASSTVPAVQNLLFLCGSRK
Sequence length 220
Interactions View interactions