NME9 (NME/NM23 family member 9)

Gene

• Entrez ID: 347736
• Gene name: NME/NM23 family member 9
• Gene symbol: NME9
• Synonyms (NCBI Gene): NM23-H9, NXL2, TXL-2, TXL2, TXNDC6
• Chromosome: 3
• Chromosome location: 3q22.3

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004550	Function	Nucleoside diphosphate kinase activity	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0006183	Process	GTP biosynthetic process	IEA
GO:0006228	Process	UTP biosynthetic process	IEA
GO:0006241	Process	CTP biosynthetic process	IEA
GO:0042995	Component	Cell projection	IEA
GO:0120293	Component	Dynein axonemal particle	IEA
GO:0120293	Component	Dynein axonemal particle	ISS

Other IDs

• MIM: 618584
• HGNC: 21343
• e!Ensembl: ENSG00000181322

Protein

• UniProt ID: Q86XW9
• Protein name: Thioredoxin domain-containing protein 6 (Thioredoxin-like protein 2) (Txl-2)
• Protein function: May be a regulator of microtubule physiology.
• PDB: 8J07
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00085	Thioredoxin	11 → 111	Thioredoxin	Domain
  PF00334	NDK	159 → 300	Nucleoside diphosphate kinase	Domain

• Tissue specificity: TISSUE SPECIFICITY: Detected at very low levels in testis, lung and brain. {ECO:0000269|PubMed:12569107}.
• Sequence:

  MGSRKKEIALQVNISTQELWEEMLSSKGLTVVDVYQGWCGPCKPVVSLFQKMRIEVGLDL
  LHFALAEADRLDVLEKYRGKCEPTFLFYAGGELVAVVRGANAPLLQKTILDQLEAEKKVL
  AEGRERKVIKDEALSDEDECVSHGKNNGEDEDMVSSERTCTLAIIKPDAVAHGKTDEIIM
  KIQEAGFEILTNEERTMTEAEVRLFYQHKAGEEAFEKLVHHMCSGPSHLLILTRTEGFED
  VVTTWRTVMGPRDPNVARREQPESLRAQYGTEMPFNAVHGSRDREDADRELALLFPSLKF
  SDKDTEAPQGGEAEATAGPTEALCFPEDVD

• Sequence length: 330

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMYOTROPHIC LATERAL SCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ATHEROSCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSLEXIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESSENTIAL HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Colorectal Neoplasms	Stimulate	23311631	★☆☆☆☆ Found in Text Mining only
Lymphoma	Associate	33603952	★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	23311631	★☆☆☆☆ Found in Text Mining only
Neoplasms	Stimulate	23311631	★☆☆☆☆ Found in Text Mining only
Testicular Diseases	Associate	33603952	★☆☆☆☆ Found in Text Mining only