LRRTM1 (leucine rich repeat transmembrane neuronal 1)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
347730
Gene name Gene Name - the full gene name approved by the HGNC.
Leucine rich repeat transmembrane neuronal 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
LRRTM1
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2p12
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(10)
miRTarBase ID miRNA Experiments Reference
MIRT021433 hsa-miR-9-5p Microarray 17612493
MIRT1121062 hsa-miR-1263 CLIP-seq
MIRT1121063 hsa-miR-3613-3p CLIP-seq
MIRT1121064 hsa-miR-509-3p CLIP-seq
MIRT1121065 hsa-miR-520d-5p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(17)
GO ID Ontology Definition Evidence Reference
GO:0003674 Function Molecular_function ND
GO:0005615 Component Extracellular space IBA 21873635
GO:0005783 Component Endoplasmic reticulum IDA 17667961
GO:0008150 Process Biological_process ND
GO:0009986 Component Cell surface IDA 17667961
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
610867 19408 ENSG00000162951
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q86UE6
Protein name Leucine-rich repeat transmembrane neuronal protein 1
Protein function Exhibits strong synaptogenic activity, restricted to excitatory presynaptic differentiation, acting at both pre- and postsynaptic level.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13855 LRR_8 113 → 173 Leucine rich repeat Repeat
PF13855 LRR_8 161 → 221 Leucine rich repeat Repeat
PF13855 LRR_8 256 → 315 Leucine rich repeat Repeat
Tissue specificity TISSUE SPECIFICITY: Predominantly expressed in forebrain regions including thalamus and cerebral cortex. {ECO:0000269|PubMed:12676565, ECO:0000269|PubMed:17667961}.
Sequence 
MDFLLLGLCLYWLLRRPSGVVLCLLGACFQMLPAAPSGCPQLCRCEGRLLYCEALNLTEA
PHNLSGLLGLSLRYNSLSELRAGQFTGLMQLTWLYLDHNHICSVQGDAFQKLRRVKELTL
SSNQITQLPNTTFRPMPNLRSVDLSYNKLQALAPDLFHGLRKLTTLHMRANAIQFVPVRI
FQDCRSLKFLDIGYNQLKSLARNSFAGLFKLTELHLEHNDLVKVNFAHFPRLISLHSLCL
RRNKVAIVVSSLDWVWNLEKMDLSGNEIEYMEPHVFETVPHLQSLQLDSNRLTYIEPRIL
NSWKSLTSITLAGNLWDCGRNVCALASWLNNFQGRYDGNLQCASPEYAQGEDVLDAVYAF
HLCEDGAEPTSGHLLSAVTNRSDLGPPASSATTLADGGEGQHDGTFEPATVALPGGEHAE
NAVQIHKVVTGTMALIFSFLIVVLVLYVSWKCFPASLRQLRQCFVTQRRKQKQKQTMHQM
AAMSAQEYYVDYKPNHIEGALVIINEYGSCTCHQQPARECEV
Sequence length 522
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Neurexins and neuroligins
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Schizophrenia Schizophrenia rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346
View all (12 more)		 17667961, 25111784
Show/Hide Text Mining Associations (2)
Associations from Text Mining
Disease Name Relationship Type References
Graves Ophthalmopathy Associate 36056316
Squamous Cell Carcinoma of Head and Neck Associate 28814981