Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	346157
Gene name	Zinc finger protein 391
Gene symbol	ZNF391
Synonyms (NCBI Gene)	dJ153G14.3
Chromosome	6
Chromosome location	6p22.1

Show/Hide all (62)

miRTarBase ID	miRNA	Experiments	Reference
MIRT724753	hsa-miR-6892-3p	HITS-CLIP	19536157
MIRT724754	hsa-miR-2276-5p	HITS-CLIP	19536157
MIRT724752	hsa-miR-3183	HITS-CLIP	19536157
MIRT724751	hsa-miR-4723-3p	HITS-CLIP	19536157
MIRT724750	hsa-miR-6769b-3p	HITS-CLIP	19536157
MIRT724749	hsa-miR-146a-3p	HITS-CLIP	19536157
MIRT724748	hsa-miR-6515-3p	HITS-CLIP	19536157
MIRT724747	hsa-miR-1236-3p	HITS-CLIP	19536157
MIRT724746	hsa-miR-3182	HITS-CLIP	19536157
MIRT724745	hsa-miR-4786-3p	HITS-CLIP	19536157
MIRT724744	hsa-miR-642a-5p	HITS-CLIP	19536157
MIRT724743	hsa-miR-7843-3p	HITS-CLIP	19536157
MIRT564485	hsa-miR-4311	PAR-CLIP	20371350
MIRT564484	hsa-miR-551b-5p	PAR-CLIP	20371350
MIRT564483	hsa-miR-890	PAR-CLIP	20371350
MIRT564482	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT564481	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT564480	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT564479	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT564478	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT564477	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT564476	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT564475	hsa-miR-4275	PAR-CLIP	20371350
MIRT564474	hsa-miR-936	PAR-CLIP	20371350
MIRT564473	hsa-miR-6828-5p	PAR-CLIP	20371350
MIRT564472	hsa-miR-671-5p	PAR-CLIP	20371350
MIRT564471	hsa-miR-6079	PAR-CLIP	20371350
MIRT442607	hsa-miR-1197	PAR-CLIP	22100165
MIRT442606	hsa-miR-3668	PAR-CLIP	22100165
MIRT442605	hsa-miR-6830-5p	PAR-CLIP	22100165
MIRT442604	hsa-miR-4480	PAR-CLIP	22100165
MIRT724753	hsa-miR-6892-3p	HITS-CLIP	19536157
MIRT724754	hsa-miR-2276-5p	HITS-CLIP	19536157
MIRT724752	hsa-miR-3183	HITS-CLIP	19536157
MIRT724751	hsa-miR-4723-3p	HITS-CLIP	19536157
MIRT724750	hsa-miR-6769b-3p	HITS-CLIP	19536157
MIRT724749	hsa-miR-146a-3p	HITS-CLIP	19536157
MIRT724748	hsa-miR-6515-3p	HITS-CLIP	19536157
MIRT724747	hsa-miR-1236-3p	HITS-CLIP	19536157
MIRT724746	hsa-miR-3182	HITS-CLIP	19536157
MIRT724745	hsa-miR-4786-3p	HITS-CLIP	19536157
MIRT724744	hsa-miR-642a-5p	HITS-CLIP	19536157
MIRT724743	hsa-miR-7843-3p	HITS-CLIP	19536157
MIRT564485	hsa-miR-4311	PAR-CLIP	20371350
MIRT564484	hsa-miR-551b-5p	PAR-CLIP	20371350
MIRT564483	hsa-miR-890	PAR-CLIP	20371350
MIRT564482	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT564481	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT564480	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT564479	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT564478	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT564477	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT564476	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT564475	hsa-miR-4275	PAR-CLIP	20371350
MIRT564474	hsa-miR-936	PAR-CLIP	20371350
MIRT564473	hsa-miR-6828-5p	PAR-CLIP	20371350
MIRT564472	hsa-miR-671-5p	PAR-CLIP	20371350
MIRT564471	hsa-miR-6079	PAR-CLIP	20371350
MIRT442607	hsa-miR-1197	PAR-CLIP	22100165
MIRT442606	hsa-miR-3668	PAR-CLIP	22100165
MIRT442605	hsa-miR-6830-5p	PAR-CLIP	22100165
MIRT442604	hsa-miR-4480	PAR-CLIP	22100165

Show/Hide all (9)

GO ID	Ontology	Definition	Evidence
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0003677	Function	DNA binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q9UJN7

Protein name

Zinc finger protein 391

Protein function

May be involved in transcriptional regulation.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00096	zf-C2H2	109 → 131	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	137 → 159	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	165 → 187	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	193 → 215	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	221 → 243	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	249 → 271	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	277 → 299	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	305 → 327	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	333 → 355	Zinc finger, C2H2 type	Domain

Sequence

MESLRGNTAQGPTNEEDYKNEGQLSRQTKCPAQKKSSFENTVVRKVSVTLKEIFTGEEGP
ESSEFSLSPNLDAQQKIPKGHGSPISRKNSKDNSDLIKHQRLFSQRKPCKCNECEKAFSY
QSDLLVHSRIHGGEKPFECNKCGKSFSRSTHLIEHQRTHTGEKPYECNECGKAFSRSTHL
SLHQRIHTGEKPYECSECGKAFSRSTNLSQHQRTHTQERPYKCNECGKAFGDRSTIIQHQ
RIHTGENPYECSKCGKAFSWISSLTEHQRTHTGENPYECSECGKVFSRSSSLTEHQRIHS
GEKPHECRVCGKGFSRSSSLIIHQRTHTGEKPYKCNDCGKAFCQSSTLIRHQHLHTKE

Sequence length

358

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POST-TRAUMATIC STRESS DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (4)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Bipolar Disorder	Associate	33822213	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder Major	Associate	33822213	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Disorders	Associate	33822213	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Associate	33822213	★★★★★ ★☆☆☆☆ Found in Text Mining only

ZNF391 (zinc finger protein 391)