APOC4 (apolipoprotein C4)

Gene

• Entrez ID: 346
• Gene name: Apolipoprotein C4
• Gene symbol: APOC4
• Synonyms (NCBI Gene): APO-CIV, APOC-IV
• Chromosome: 19
• Chromosome location: 19q13.32
• Summary: This gene encodes a lipid-binding protein belonging to the apolipoprotein gene family. The protein is thought to play a role in lipid metabolism. Polymorphisms in this gene may influence circulating lipid levels and may be associated with coronary artery

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1933044	hsa-miR-1200	CLIP-seq
MIRT1933045	hsa-miR-3199	CLIP-seq
MIRT1933046	hsa-miR-4258	CLIP-seq
MIRT1933047	hsa-miR-4269	CLIP-seq
MIRT1933048	hsa-miR-4324	CLIP-seq
MIRT1933049	hsa-miR-4438	CLIP-seq
MIRT1933050	hsa-miR-4777-3p	CLIP-seq
MIRT1933051	hsa-miR-5095	CLIP-seq
MIRT1933052	hsa-miR-544b	CLIP-seq
MIRT2173229	hsa-miR-3663-5p	CLIP-seq
MIRT2173230	hsa-miR-4423-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005319	Function	Lipid transporter activity	TAS	8530039
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0006629	Process	Lipid metabolic process	TAS	8530039
GO:0006869	Process	Lipid transport	IEA
GO:0019915	Process	Lipid storage	IMP	18809223
GO:0034361	Component	Very-low-density lipoprotein particle	IBA
GO:0034361	Component	Very-low-density lipoprotein particle	IDA	12700345, 17154273
GO:0034361	Component	Very-low-density lipoprotein particle	IEA
GO:0034361	Component	Very-low-density lipoprotein particle	IMP	8827523
GO:0034364	Component	High-density lipoprotein particle	IBA
GO:0034364	Component	High-density lipoprotein particle	IDA	12700345
GO:0070328	Process	Triglyceride homeostasis	IBA
GO:0070328	Process	Triglyceride homeostasis	IMP	8827523

Other IDs

• MIM: 600745
• HGNC: 611
• e!Ensembl: ENSG00000267467

Protein

• UniProt ID: P55056
• Protein name: Apolipoprotein C-IV (Apo-CIV) (ApoC-IV) (Apolipoprotein C4)
• Protein function: May participate in lipoprotein metabolism.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15119	APOC4	31 → 124	Apolipoprotein C4	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed by the liver and secreted in plasma.
• Sequence:

  MSLLRNRLQALPALCLCVLVLACIGACQPEAQEGTLSPPPKLKMSRWSLVRGRMKELLET
  VVNRTRDGWQWFWSPSTFRGFMQTYYDDHLRDLGPLTKAWFLESKDSLLKKTHSLCPRLV
  CGDKDQG

• Sequence length: 127

Pathways

Reactome:

VLDL assembly
VLDL clearance
NR1H3 & NR1H2 regulate gene expression linked to cholesterol transport and efflux