Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	346
Gene name Gene Name - the full gene name approved by the HGNC.	Apolipoprotein C4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	APOC4
Synonyms (NCBI Gene) Gene synonyms aliases	APO-CIV, APOC-IV
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19q13.32
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a lipid-binding protein belonging to the apolipoprotein gene family. The protein is thought to play a role in lipid metabolism. Polymorphisms in this gene may influence circulating lipid levels and may be associated with coronary artery

Show/Hide all(11)

miRTarBase ID	miRNA	Experiments
MIRT1933044	hsa-miR-1200	CLIP-seq
MIRT1933045	hsa-miR-3199	CLIP-seq
MIRT1933046	hsa-miR-4258	CLIP-seq
MIRT1933047	hsa-miR-4269	CLIP-seq
MIRT1933048	hsa-miR-4324	CLIP-seq
MIRT1933049	hsa-miR-4438	CLIP-seq
MIRT1933050	hsa-miR-4777-3p	CLIP-seq
MIRT1933051	hsa-miR-5095	CLIP-seq
MIRT1933052	hsa-miR-544b	CLIP-seq
MIRT2173229	hsa-miR-3663-5p	CLIP-seq
MIRT2173230	hsa-miR-4423-5p	CLIP-seq

Show/Hide all(15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005319	Function	Lipid transporter activity	TAS	8530039
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0006629	Process	Lipid metabolic process	TAS	8530039
GO:0006869	Process	Lipid transport	IEA
GO:0019915	Process	Lipid storage	IMP	18809223
GO:0034361	Component	Very-low-density lipoprotein particle	IBA
GO:0034361	Component	Very-low-density lipoprotein particle	IDA	12700345, 17154273
GO:0034361	Component	Very-low-density lipoprotein particle	IEA
GO:0034361	Component	Very-low-density lipoprotein particle	IMP	8827523
GO:0034364	Component	High-density lipoprotein particle	IBA
GO:0034364	Component	High-density lipoprotein particle	IDA	12700345
GO:0070328	Process	Triglyceride homeostasis	IBA
GO:0070328	Process	Triglyceride homeostasis	IMP	8827523

MIM	HGNC	e!Ensembl
600745	611	ENSG00000267467

Protein

UniProt ID

P55056

Protein name

Apolipoprotein C-IV (Apo-CIV) (ApoC-IV) (Apolipoprotein C4)

Protein function

May participate in lipoprotein metabolism.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15119	APOC4	31 → 124	Apolipoprotein C4	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed by the liver and secreted in plasma.

Sequence

MSLLRNRLQALPALCLCVLVLACIGACQPEAQEGTLSPPPKLKMSRWSLVRGRMKELLET
VVNRTRDGWQWFWSPSTFRGFMQTYYDDHLRDLGPLTKAWFLESKDSLLKKTHSLCPRLV
CGDKDQG

Sequence length

127

Interactions

View interactions

	Reactome
			VLDL assembly VLDL clearance NR1H3 & NR1H2 regulate gene expression linked to cholesterol transport and efflux

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Alzheimer disease	Alzheimer's disease or family history of Alzheimer's disease, Alzheimer's disease or gastroesophageal reflux disease	N/A	N/A	GWAS

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Alzheimer Disease	Associate	39201500
Breast Neoplasms	Associate	28160560
Coronary Artery Disease	Associate	26129832, 39201500
Fatty Liver	Associate	18809223
Pneumonia Lipid	Associate	25005712

APOC4 (apolipoprotein C4)