Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3456
Gene name	Interferon beta 1
Gene symbol	IFNB1
Synonyms (NCBI Gene)	IFBIFFIFN-betaIFNB
Chromosome	9
Chromosome location	9p21.3
Summary	This gene encodes a cytokine that belongs to the interferon family of signaling proteins, which are released as part of the innate immune response to pathogens. The protein encoded by this gene belongs to the type I class of interferons, which are importa

Show/Hide all (24)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004614	hsa-let-7b-5p	ELISALuciferase reporter assayqRT-PCR	20130213
MIRT004615	hsa-miR-26a-5p	ELISALuciferase reporter assayqRT-PCR	20130213
MIRT004616	hsa-miR-145-5p	ELISALuciferase reporter assayqRT-PCR	20130213
MIRT004617	hsa-miR-34a-5p	ELISALuciferase reporter assayqRT-PCR	20130213
MIRT644955	hsa-miR-548c-3p	HITS-CLIP	23824327
MIRT644954	hsa-miR-4282	HITS-CLIP	23824327
MIRT644953	hsa-miR-3606-3p	HITS-CLIP	23824327
MIRT644952	hsa-miR-513a-3p	HITS-CLIP	23824327
MIRT644951	hsa-miR-513c-3p	HITS-CLIP	23824327
MIRT644950	hsa-miR-8063	HITS-CLIP	23824327
MIRT644949	hsa-miR-4698	HITS-CLIP	23824327
MIRT644948	hsa-miR-6080	HITS-CLIP	23824327
MIRT644947	hsa-miR-607	HITS-CLIP	23824327
MIRT736422	hsa-miR-491-3p	qRT-PCRFlow cytometry	33679688
MIRT004616	hsa-miR-145-5p	Western blottingqRT-PCRELISA	32808389
MIRT644955	hsa-miR-548c-3p	HITS-CLIP	23824327
MIRT644954	hsa-miR-4282	HITS-CLIP	23824327
MIRT644953	hsa-miR-3606-3p	HITS-CLIP	23824327
MIRT644952	hsa-miR-513a-3p	HITS-CLIP	23824327
MIRT644951	hsa-miR-513c-3p	HITS-CLIP	23824327
MIRT644950	hsa-miR-8063	HITS-CLIP	23824327
MIRT644949	hsa-miR-4698	HITS-CLIP	23824327
MIRT644948	hsa-miR-6080	HITS-CLIP	23824327
MIRT644947	hsa-miR-607	HITS-CLIP	23824327

Show/Hide all (21)

Transcription factor	Regulation	Reference
ATF2	Activation	17496231
ATF2	Unknown	10848607
IRF1	Activation	8021262
IRF1	Unknown	17073600;18575764;22547704
IRF2	Activation	8021262
IRF2	Unknown	17073600
IRF3	Activation	12077266;17496231;23096996
IRF3	Unknown	10848607;15955070;16125763;17079305;19541850;20048166;20453844;20483755
IRF7	Activation	17236232
IRF7	Repression	22698399
IRF7	Unknown	22547704;23906644
JUN	Unknown	10848607
NFKB1	Activation	10074115;12077266;17496231
NFKB1	Unknown	15955070;16125763;17079305
NFKBIA	Repression	10074115
NFKBIB	Repression	10074115
PML	Activation	11042692
RELA	Activation	10074115;12077266;17496231
RELA	Unknown	15955070;16125763;17079305;22547704
STAT1	Repression	19096445
YY1	Unknown	22065573

Show/Hide all (68)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002250	Process	Adaptive immune response	IBA
GO:0002286	Process	T cell activation involved in immune response	IBA
GO:0002312	Process	B cell activation involved in immune response	IBA
GO:0002312	Process	B cell activation involved in immune response	IMP	12932356
GO:0002323	Process	Natural killer cell activation involved in immune response	IBA
GO:0002683	Process	Negative regulation of immune system process	IEA
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IDA	6157094, 7813427, 8027027, 8969169, 10556041, 19008854, 33581076
GO:0005125	Function	Cytokine activity	IEA
GO:0005126	Function	Cytokine receptor binding	IDA	10556041
GO:0005126	Function	Cytokine receptor binding	IEA
GO:0005126	Function	Cytokine receptor binding	IPI	7813427, 8798579, 8969169
GO:0005132	Function	Type I interferon receptor binding	IBA
GO:0005132	Function	Type I interferon receptor binding	NAS	2414376
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	6157094, 21873635
GO:0005615	Component	Extracellular space	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IDA	9020188, 28753426
GO:0006950	Process	Response to stress	IEA
GO:0006952	Process	Defense response	IEA
GO:0006955	Process	Immune response	IEA
GO:0006959	Process	Humoral immune response	IBA
GO:0007165	Process	Signal transduction	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	TAS	10640778
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	IDA	7813427, 8027027, 8798579, 8969169
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	IDA	7526154, 7657660, 7759950, 8605876, 23139419, 28753426
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	IDA	10556041
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	TAS	8232552
GO:0008811	Function	Chloramphenicol O-acetyltransferase activity	IMP	19176627
GO:0009615	Process	Response to virus	NAS	12120696
GO:0009893	Process	Positive regulation of metabolic process	IEA
GO:0010508	Process	Positive regulation of autophagy	ISS
GO:0019221	Process	Cytokine-mediated signaling pathway	IDA	6157094, 7813427
GO:0030101	Process	Natural killer cell activation	NAS	11987821
GO:0035458	Process	Cellular response to interferon-beta	IDA	7759950
GO:0035458	Process	Cellular response to interferon-beta	IDA	7813427, 8027027, 8969169, 18035482
GO:0042100	Process	B cell proliferation	NAS	3135963
GO:0043330	Process	Response to exogenous dsRNA	IBA
GO:0043330	Process	Response to exogenous dsRNA	IDA	21266579
GO:0045071	Process	Negative regulation of viral genome replication	IDA	19008854
GO:0045087	Process	Innate immune response	IDA	7813427
GO:0045089	Process	Positive regulation of innate immune response	NAS	11987821
GO:0045321	Process	Leukocyte activation	IEA
GO:0045343	Process	Regulation of MHC class I biosynthetic process	NAS	8805651
GO:0045581	Process	Negative regulation of T cell differentiation	IDA	20554961
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	18035482
GO:0051241	Process	Negative regulation of multicellular organismal process	IEA
GO:0051607	Process	Defense response to virus	IEA
GO:0051607	Process	Defense response to virus	ISS
GO:0051607	Process	Defense response to virus	TAS	19416887
GO:0060337	Process	Type I interferon-mediated signaling pathway	IBA
GO:0060337	Process	Type I interferon-mediated signaling pathway	IDA	18035482, 33581076
GO:0060337	Process	Type I interferon-mediated signaling pathway	NAS	30936491
GO:0070050	Process	Neuron cellular homeostasis	ISS
GO:0071359	Process	Cellular response to dsRNA	IEA
GO:0071360	Process	Cellular response to exogenous dsRNA	TAS	21266579
GO:0097696	Process	Cell surface receptor signaling pathway via STAT	IDA	18035482
GO:0098586	Process	Cellular response to virus	IEA
GO:0098586	Process	Cellular response to virus	IEP	28146100
GO:0098586	Process	Cellular response to virus	NAS	30936491
GO:0140123	Process	Negative regulation of Lewy body formation	ISS
GO:0140374	Process	Antiviral innate immune response	IDA	19008854, 19416887, 21642987
GO:1900182	Process	Positive regulation of protein localization to nucleus	IDA	8605876, 26479788
GO:2000552	Process	Negative regulation of T-helper 2 cell cytokine production	IDA	20554961
GO:2001235	Process	Positive regulation of apoptotic signaling pathway	IDA	10918594, 11337497

MIM	HGNC	e!Ensembl
147640	5434	ENSG00000171855

P01574

Protein name

Interferon beta (IFN-beta) (Fibroblast interferon)

Protein function

Type I interferon cytokine that plays a key role in the innate immune response to infection, developing tumors and other inflammatory stimuli (PubMed:10049744, PubMed:10556041, PubMed:6157094, PubMed:6171735, PubMed:7665574, PubMed:8027027, PubM

PDB

1AU1

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00143	Interferon	27 → 185	Interferon alpha/beta domain	Domain

Sequence

MTNKCLLQIALLLCFSTTALSMSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFD
IPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLK
TVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINR
LTGYLRN

Sequence length

187

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction PI3K-Akt signaling pathway Necroptosis Osteoclast differentiation Toll-like receptor signaling pathway NOD-like receptor signaling pathway RIG-I-like receptor signaling pathway Cytosolic DNA-sensing pathway JAK-STAT signaling pathway Natural killer cell mediated cytotoxicity TNF signaling pathway Alcoholic liver disease Shigellosis Yersinia infection Chagas disease Tuberculosis Hepatitis C Hepatitis B Measles Human cytomegalovirus infection Influenza A Human papillomavirus infection Kaposi sarcoma-associated herpesvirus infection Herpes simplex virus 1 infection Epstein-Barr virus infection Human immunodeficiency virus 1 infection Coronavirus disease - COVID-19 Lipid and atherosclerosis		Oxidative Stress Induced Senescence Interferon alpha/beta signaling Regulation of IFNA signaling TRAF3-dependent IRF activation pathway TRAF6 mediated IRF7 activation Factors involved in megakaryocyte development and platelet production

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Multisystem inflammatory syndrome in children	Uncertain significance	rs747015309	RCV001779418

Show/Hide Text Mining Associations (232)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenomyosis	Associate	34010983
Agnosia	Associate	38482990
AIDS Related Complex	Associate	2415279
Allergic Fungal Sinusitis	Inhibit	31449915
Alzheimer Disease	Stimulate	30076830
Amyloidosis Hereditary Transthyretin Related	Stimulate	31253122
Antisynthetase syndrome	Associate	34905301
Aortic Aneurysm Thoracic	Associate	35510553
Apraxia Ideomotor	Associate	32765497
Arthritis Rheumatoid	Associate	10693865, 11219394, 15878901, 22614743, 26882897, 32765497, 33387195, 36189314
Arthritis Rheumatoid	Inhibit	14672890
Arthritis Rheumatoid	Stimulate	37934808
Asthma	Associate	18653650, 24450586, 24475887, 27622317, 27695127, 28192616, 30950247, 32394602, 33515711, 34733277, 34916261, 38494094
Asthma	Inhibit	31849956
Astrocytoma	Associate	18457922, 8798467
Atherosclerosis	Stimulate	35860283
Autoimmune Diseases	Inhibit	15544628
Autoimmune Diseases	Associate	23402527, 26882897, 30250011, 32033836, 34848794
Bacterial Infections	Associate	35767946, 36189314
Behcet Syndrome	Associate	17177965
Bipolar Disorder	Associate	38482990
Blood Platelet Disorders	Associate	35217532
Breast Neoplasms	Associate	19000652, 22396773, 23370279, 31036052, 33476079, 33770100, 34315857, 8989922
Breast Neoplasms	Inhibit	27129156, 9889406
Bruton type agammaglobulinemia	Associate	30147693
Carcinogenesis	Associate	21389130, 26308599
Carcinoma Hepatocellular	Associate	17517627, 18781139, 25100852
Carcinoma Renal Cell	Associate	25227113, 35995140, 36932108, 7753843
Carcinoma Squamous Cell	Associate	9889406
Cardiovascular Diseases	Stimulate	23019656
Cartilage Diseases	Associate	14672890
CD59 Deficiency	Stimulate	25025430
Celiac Disease	Associate	32033836
Central Nervous System Diseases	Inhibit	12068083
Chemical and Drug Induced Liver Injury	Associate	22106296, 30013178
Chromosome Aberrations	Stimulate	32597933
chronic atypical neutrophilic dermatosis with lipodystrophy and elevated temperature	Associate	32252809
Cognition Disorders	Associate	38482990
Colorectal Neoplasms	Associate	15970687, 31869529, 33853514, 35749909, 37972702
Common Variable Immunodeficiency	Associate	19592080
Communicable Diseases	Associate	36341423
Coronavirus Infections	Inhibit	24503068
Coronavirus Infections	Associate	33486513
COVID 19	Inhibit	22876772, 24503068, 34769072, 35767946
COVID 19	Associate	32706371, 32737579, 33486513, 33662681, 33767713, 34133897, 34714440, 34716309, 35217532, 35419822, 35648256, 35878012, 36126729, 36163411, 36924609, 37261339, 38140545 View all (2 more)
COVID 19	Stimulate	36107502, 36628928
Cytomegalovirus Infections	Associate	39331212
Death	Associate	36932108
Dengue	Associate	28212581
Dermatitis	Stimulate	32954523
Dermatitis Atopic	Associate	11091268
Dermatitis Atopic 1	Stimulate	23212197, 34916261
Dermatomyositis	Associate	17968926, 22235269, 32252809, 32954523, 33675790, 34905301, 37094222
Dermatomyositis	Stimulate	18936398, 33766508
Dermatomyositis	Inhibit	34983619
Diabetes Mellitus	Associate	17303922
Diabetes Mellitus Type 1	Associate	17303922
Digestive System Diseases	Associate	30044791
DNA Virus Infections	Associate	24799566
Down Syndrome	Associate	1825795
Drug Related Side Effects and Adverse Reactions	Stimulate	25684207, 36074772
Drug Related Side Effects and Adverse Reactions	Associate	37986544
Dry Eye Syndromes	Inhibit	37026295
Emphysema	Associate	32946850
Encephalitis	Associate	17626075
Encephalitis Herpes Simplex	Associate	21722947, 23103873, 32960813
Encephalitis Japanese	Associate	24485101
Encephalomyelitis Autoimmune Experimental	Associate	33291536
Endodermal Sinus Tumor	Associate	37986544
Endometrial Neoplasms	Associate	21226949, 22252463, 36509095
Endometriosis	Associate	36509095
Enterovirus Infections	Associate	37117225
Epstein Barr Virus Infections	Stimulate	25025430
Esophageal Squamous Cell Carcinoma	Associate	16101138
Fasciitis	Associate	34381187
Glioblastoma	Associate	26379193, 26441059, 32860072
Glioblastoma	Inhibit	26397698
Glioma	Associate	1282676, 1386261, 26397698, 31638255, 8532125
Glioma	Inhibit	18180770, 21472719
Glomerulonephritis	Associate	30808838
Helicobacter Infections	Associate	36317079
Hepatitis C	Stimulate	17804510
Hepatitis C Chronic	Inhibit	35767946
Hepatitis D	Associate	38143742
Hepatoblastoma	Associate	7783683
Hereditary Autoinflammatory Diseases	Associate	25307056
Herpes Simplex	Stimulate	34072468
HIV Infections	Associate	16174727, 1700829, 19299650, 24367701, 31511380, 33913525, 9326655
HTLV I Infections	Associate	28331088
Huntington Disease Like 3	Associate	23103873
Hypersensitivity Immediate	Associate	31836668
Hypoxia Brain	Stimulate	28819164, 37905653
Idiopathic Noncirrhotic Portal Hypertension	Inhibit	18552464
Ige Responsiveness Atopic	Inhibit	24811725
Ige Responsiveness Atopic	Associate	34733277
Immune System Diseases	Associate	32033836
Immunologic Deficiency Syndromes	Stimulate	21911422
Immunologic Deficiency Syndromes	Associate	35670811
Infections	Inhibit	12654014, 22018491, 26609934, 29813068
Infections	Stimulate	15516717, 20130065, 20154210, 22676157, 23797008, 24219422, 24223733, 26732368, 31817126, 32094077, 33277988, 40243606
Infections	Associate	17804510, 23529854, 24367701, 24811725, 30808838, 32394602
Inflammation	Inhibit	10705303, 14672890, 15878901, 17364493, 19559654, 28786780
Inflammation	Associate	11750216, 12068083, 12437583, 16846531, 16867161, 17579079, 18494930, 18653650, 23166786, 24223820, 27690673, 28794402, 30808838, 31252545, 31785031 View all (11 more)
Inflammation	Stimulate	31426476, 38317053
Influenza Human	Stimulate	15516717, 26285213
Influenza Human	Associate	24223820, 34281396, 36070294, 37445672, 39591472
Intellectual Disability	Associate	38482990
Kidney Diseases	Stimulate	30201809
Leprosy Lepromatous	Associate	23449998
Leukemia	Associate	37554265
Leukemia Lymphoma Adult T Cell	Inhibit	26819312
Leukemia Myeloid Acute	Associate	1386261, 36418348
Leukemia T Cell	Associate	8100486
Leukoencephalopathy Progressive Multifocal	Associate	17674314
Lichen Planus	Associate	18055547
Lichen Planus Oral	Associate	35644988
Lipoma	Associate	15755872
Liposarcoma	Stimulate	11278855
Livedoid Vasculopathy	Associate	32252809
Liver Cirrhosis	Associate	15661146
Liver Cirrhosis Biliary	Associate	15856047
Liver Diseases	Associate	15991303
Liver Failure	Stimulate	30013178
Liver Neoplasms	Associate	38279326
Lung Neoplasms	Associate	26308599
Lung Neoplasms	Inhibit	26351076
Lupus Erythematosus Cutaneous	Associate	11438470
Lupus Erythematosus Systemic	Stimulate	11438470, 16645992, 22036215, 27110677, 28471483, 36165181
Lupus Erythematosus Systemic	Associate	19479852, 20720564, 22859983, 26882897, 29227470, 30201809, 31044165, 31969218, 33336388
Lupus Nephritis	Associate	27338297
Lupus Nephritis	Stimulate	36355567
Lymphoma Large B Cell Diffuse	Associate	31432184, 6376119
Malformations of Cortical Development Group I	Stimulate	22144678
Malformations of Cortical Development Group I	Associate	22144678
Medulloblastoma	Associate	28559152
Melanoma	Associate	11058161, 12029096, 12067474, 1438246, 18511292, 2124247, 21338484, 25333256, 25728676, 7954528
Melanoma	Inhibit	11892816, 20547861, 21235385
Mesothelioma	Associate	23977343
Mesothelioma Malignant	Associate	20068553, 31945495
Metabolism Inborn Errors	Associate	34015270
Mitral Valve Insufficiency	Associate	11091268
Mixed Connective Tissue Disease	Associate	33336388
Mouth Diseases	Associate	11091268, 37117225
Mouth Neoplasms	Associate	19297561
Multi centric Castleman's Disease	Associate	32376796
Multiple Myeloma	Associate	8978300
Multiple Sclerosis	Associate	10193428, 11422209, 12562396, 12745437, 17258784, 17364493, 19478017, 19883335, 20074275, 20526818, 20621365, 20656764, 21061396, 21886806, 22182694 View all (37 more)
Multiple Sclerosis	Inhibit	10705303, 10736102, 11673527, 12068083, 12437583, 14567559, 15544628, 16709257, 16867161, 18656179, 18825744, 19559654, 19604093, 20068068, 21427490 View all (27 more)
Multiple Sclerosis Relapsing Remitting	Inhibit	10705303, 17897326, 18382694, 21949733, 22106296, 22711062, 23166786, 23592979, 23637780, 25392319, 25586466, 27828855, 28417621, 33291536, 33343562, 33463108, 34113337, 38545756 View all (3 more)
Multiple Sclerosis Relapsing Remitting	Associate	26395032, 34975865
Muscular Atrophy	Associate	36854567
Muscular Atrophy Spinal	Associate	11147573
Myocarditis	Associate	28359509, 32686697
Myositis	Associate	22094963, 30886734
Neoplasm Metastasis	Associate	37972702
Neoplasms	Inhibit	10924506, 11673527, 11953436, 20068068, 22159640, 23977343, 24460759, 26397698, 27129156, 29229854, 31036052, 34897916, 6584908, 9774665
Neoplasms	Associate	17376236, 17442890, 19640730, 21226949, 22106296, 22396773, 22842821, 23145063, 23630584, 24008363, 26308599, 27176664, 29750542, 29849115, 32391191 View all (16 more)
Neoplasms	Stimulate	22615843
Nephritis	Associate	36355567
Neurocognitive Disorders	Associate	38482990
Neuroendocrine Tumors	Associate	19141687
Neuroinflammatory Diseases	Associate	24472094
Neurologic Manifestations	Associate	35639375
Neuromyelitis Optica	Associate	22036215
Neutropenia	Stimulate	34320929
Osteoarthritis	Associate	14672890, 25407789
Osteoporosis	Associate	25563300
Osteoporotic Fractures	Associate	25563300
Osteosarcoma	Associate	35662245
Ovarian Neoplasms	Associate	11337497, 11896621, 37342328, 38373690
Ovarian Neoplasms	Inhibit	15634191
Pancreatic Neoplasms	Inhibit	17667505
Pancreatic Neoplasms	Associate	24460759, 37117225, 39372406
Papillomavirus Infections	Associate	33164635
Paramyxoviridae Infections	Associate	19922606
Paraparesis Tropical Spastic	Associate	24472094
Parkinson Disease	Associate	18197754
pediatric multisystem inflammatory disease COVID 19 related	Associate	35639375
Platelet Signal Processing Defect	Associate	34678150
Pleural Effusion	Associate	29504148
Pleural Effusion Malignant	Associate	20068553
Polymyositis	Associate	17968926
Polyomavirus Infections	Associate	31252545
Post Acute COVID 19 Syndrome	Associate	38522030
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	2294436
Prolidase Deficiency	Inhibit	26159719
Prostatic Neoplasms	Associate	24264315, 26339361, 33893074, 37068442, 38057852
Prostatic Neoplasms Castration Resistant	Associate	37581614, 38057852
Prostatitis	Associate	7753843
Psoriasis	Associate	31577850
Pulmonary Disease Chronic Obstructive	Associate	23384071, 26283481, 27418822, 27695127
Pulmonary Disease Chronic Obstructive	Inhibit	31170225
Respiratory Distress Syndrome	Associate	32321279
Respiratory Sounds	Inhibit	24811725
Respiratory Syncytial Virus Infections	Associate	22730064, 27695127
Respiratory Tract Infections	Associate	11750216, 32394602, 34714440
Retinal Vasculitis	Stimulate	17177965
Retinitis Pigmentosa 33	Associate	27454487
Rhabdomyosarcoma	Associate	23797008
Rhinitis Allergic	Associate	27667736
RNA Virus Infections	Associate	23650567
RNA Virus Infections	Stimulate	30021902
Rubella	Associate	18715339
Sarcoidosis Pulmonary	Associate	29237089
Sarcoma Ewing	Associate	30131449
Sepsis	Associate	34566996
Sjogren's Syndrome	Associate	18581327, 30446998, 34149728, 35860283
Skin Diseases	Stimulate	15544628, 31577850
Skin Diseases	Associate	19479852
Sleep Deprivation	Stimulate	15516717
Spinal Cord Diseases	Inhibit	36835179
Spondyloenchondrodysplasia	Associate	25307056
Squamous Cell Carcinoma of Head and Neck	Associate	18819931, 19297561
Status Asthmaticus	Associate	15781584, 23212197, 23824215, 28262704, 32394602
Status Asthmaticus	Stimulate	27622317
Status Asthmaticus	Inhibit	29698627, 30950247
Still's Disease Adult Onset	Stimulate	35123211
Stomach Neoplasms	Associate	20507321, 22159640, 33843442
Tetany	Inhibit	37094222
Thymus Neoplasms	Associate	12050353
Triple Negative Breast Neoplasms	Associate	29229854, 29750542, 31036052, 39593161
Tuberculosis	Associate	29504148, 39232642
Urinary Bladder Neoplasms	Associate	23392170
Uterine Cervical Neoplasms	Associate	10521926, 11739693, 24358111, 27883176
Uterine Diseases	Associate	34010983
Uveitis	Associate	17177965
Vaccinia	Stimulate	21354589
Ventricular Remodeling	Associate	11750216
Virus Diseases	Stimulate	10585427, 2537976, 9777250
Virus Diseases	Associate	11943871, 12068083, 12654014, 16585524, 17651439, 18653650, 19523662, 22792062, 23103873, 23449998, 24788318, 27604339, 27824081, 30723748, 30808838, 30996104, 36736301, 37005687, 8552072 View all (4 more)
Virus Diseases	Inhibit	22223339, 33259798
Vision Disorders	Associate	25678110

IFNB1 (interferon beta 1)