Gene Gene information from NCBI Gene database.
Entrez ID 345557
Gene name Phosphatidylinositol specific phospholipase C X domain containing 3
Gene symbol PLCXD3
Synonyms (NCBI Gene)
-
Chromosome 5
Chromosome location 5p13.1
miRNA miRNA information provided by mirtarbase database.
560
miRTarBase ID miRNA Experiments Reference
MIRT654982 hsa-miR-100-3p HITS-CLIP 19536157
MIRT654980 hsa-miR-4327 HITS-CLIP 19536157
MIRT654979 hsa-miR-455-3p HITS-CLIP 19536157
MIRT632583 hsa-miR-6875-3p HITS-CLIP 19536157
MIRT618723 hsa-miR-4659a-3p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
9
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005737 Component Cytoplasm IEA
GO:0006629 Process Lipid metabolic process IEA
GO:0007165 Process Signal transduction IEA
GO:0008081 Function Phosphoric diester hydrolase activity IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
617016 31822 ENSG00000182836
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q63HM9
Protein name PI-PLC X domain-containing protein 3
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed at highest levels in heart. Also detected in kidney, lung, small intestine and colon. Expressed at very low levels, if any, in leukocytes, thymus and skeletal muscle. {ECO:0000269|PubMed:22732399}.
Sequence
MASSQGKNELKLADWMATLPESMHSIPLTNLAIPGSHDSFSFYIDEASPVGPEQPETVQN
FVSVFGTVAKKLMRKWLATQTMNFTGQLGAGIRYFDLRISTKPRDPDNELYFAHGLFSAK
VNEGLEEINAFLTDHHKEVVFLDFNHFYGMQKYHHEKLVQMLKDIYGNKMCPAIFAQEVS
LKYLWEKDYQVLVFYHSPVALEVPFLWPGQMMPAPWANTTDPEKLIQFLQASITERRKKG
SFFISQVVLTPKASTVVKGVASGLRETITERALPAMMQWVRTQKPGESGINIVTADFVEL
GDFISTVIKLNYVFDEGEANT
Sequence length 321
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Melanoma Uncertain significance rs760798700 RCV005932712
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Androgen Insensitivity Syndrome Associate 31671693
Bipolar Disorder Associate 25111785
Creutzfeldt Jakob Syndrome Associate 24028506
Diabetes Mellitus Type 2 Associate 32570874
Metabolic Syndrome Associate 32570874