Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
345557
Gene name Gene Name - the full gene name approved by the HGNC.
Phosphatidylinositol specific phospholipase C X domain containing 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PLCXD3
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5p13.1
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT654982 hsa-miR-100-3p HITS-CLIP 19536157
MIRT654980 hsa-miR-4327 HITS-CLIP 19536157
MIRT654979 hsa-miR-455-3p HITS-CLIP 19536157
MIRT632583 hsa-miR-6875-3p HITS-CLIP 19536157
MIRT618723 hsa-miR-4659a-3p HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005737 Component Cytoplasm IEA
GO:0007165 Process Signal transduction IEA
GO:0008081 Function Phosphoric diester hydrolase activity IEA
GO:0016042 Process Lipid catabolic process IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
617016 31822 ENSG00000182836
Protein
UniProt ID Q63HM9
Protein name PI-PLC X domain-containing protein 3
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed at highest levels in heart. Also detected in kidney, lung, small intestine and colon. Expressed at very low levels, if any, in leukocytes, thymus and skeletal muscle. {ECO:0000269|PubMed:22732399}.
Sequence
MASSQGKNELKLADWMATLPESMHSIPLTNLAIPGSHDSFSFYIDEASPVGPEQPETVQN
FVSVFGTVAKKLMRKWLATQTMNFTGQLGAGIRYFDLRISTKPRDPDNELYFAHGLFSAK
VNEGLEEINAFLTDHHKEVVFLDFNHFYGMQKYHHEKLVQMLKDIYGNKMCPAIFAQEVS
LKYLWEKDYQVLVFYHSPVALEVPFLWPGQMMPAPWANTTDPEKLIQFLQASITERRKKG
SFFISQVVLTPKASTVVKGVASGLRETITERALPAMMQWVRTQKPGESGINIVTADFVEL
GDFISTVIKLNYVFDEGEANT
Sequence length 321
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Unknown
Disease term Disease name Evidence References Source
Bipolar Disorder Bipolar Disorder GWAS
Associations from Text Mining
Disease Name Relationship Type References
Androgen Insensitivity Syndrome Associate 31671693
Bipolar Disorder Associate 25111785
Creutzfeldt Jakob Syndrome Associate 24028506
Diabetes Mellitus Type 2 Associate 32570874
Metabolic Syndrome Associate 32570874