Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	345275
Gene name	Hydroxysteroid 17-beta dehydrogenase 13
Gene symbol	HSD17B13
Synonyms (NCBI Gene)	FLDPHMFN0376NIIL497SCDR9SDR16C3
Chromosome	4
Chromosome location	4q22.1

155

Show/Hide all (155)

miRTarBase ID	miRNA	Experiments
MIRT1055373	hsa-miR-100	CLIP-seq
MIRT1055374	hsa-miR-1283	CLIP-seq
MIRT1055375	hsa-miR-1908	CLIP-seq
MIRT1055376	hsa-miR-2114	CLIP-seq
MIRT1055377	hsa-miR-3122	CLIP-seq
MIRT1055378	hsa-miR-3160-3p	CLIP-seq
MIRT1055379	hsa-miR-3165	CLIP-seq
MIRT1055380	hsa-miR-3613-3p	CLIP-seq
MIRT1055381	hsa-miR-3664-3p	CLIP-seq
MIRT1055382	hsa-miR-3665	CLIP-seq
MIRT1055383	hsa-miR-3689a-3p	CLIP-seq
MIRT1055384	hsa-miR-3689c	CLIP-seq
MIRT1055385	hsa-miR-3913-5p	CLIP-seq
MIRT1055386	hsa-miR-3929	CLIP-seq
MIRT1055387	hsa-miR-4419b	CLIP-seq
MIRT1055388	hsa-miR-4433	CLIP-seq
MIRT1055389	hsa-miR-4455	CLIP-seq
MIRT1055390	hsa-miR-4459	CLIP-seq
MIRT1055391	hsa-miR-4478	CLIP-seq
MIRT1055392	hsa-miR-4486	CLIP-seq
MIRT1055393	hsa-miR-4487	CLIP-seq
MIRT1055394	hsa-miR-4683	CLIP-seq
MIRT1055395	hsa-miR-4684-5p	CLIP-seq
MIRT1055396	hsa-miR-4695-5p	CLIP-seq
MIRT1055397	hsa-miR-4728-5p	CLIP-seq
MIRT1055398	hsa-miR-4736	CLIP-seq
MIRT1055399	hsa-miR-4767	CLIP-seq
MIRT1055400	hsa-miR-4786-5p	CLIP-seq
MIRT1055401	hsa-miR-4793-3p	CLIP-seq
MIRT1055402	hsa-miR-485-5p	CLIP-seq
MIRT1055403	hsa-miR-487a	CLIP-seq
MIRT1055404	hsa-miR-508-5p	CLIP-seq
MIRT1055405	hsa-miR-510	CLIP-seq
MIRT1055406	hsa-miR-512-5p	CLIP-seq
MIRT1055407	hsa-miR-558	CLIP-seq
MIRT1055408	hsa-miR-566	CLIP-seq
MIRT1055409	hsa-miR-661	CLIP-seq
MIRT1055410	hsa-miR-663	CLIP-seq
MIRT1055411	hsa-miR-766	CLIP-seq
MIRT1055412	hsa-miR-99a	CLIP-seq
MIRT1055413	hsa-miR-99b	CLIP-seq
MIRT1055381	hsa-miR-3664-3p	CLIP-seq
MIRT1055386	hsa-miR-3929	CLIP-seq
MIRT1055387	hsa-miR-4419b	CLIP-seq
MIRT1055388	hsa-miR-4433	CLIP-seq
MIRT1055390	hsa-miR-4459	CLIP-seq
MIRT1055391	hsa-miR-4478	CLIP-seq
MIRT1055396	hsa-miR-4695-5p	CLIP-seq
MIRT1055402	hsa-miR-485-5p	CLIP-seq
MIRT1055405	hsa-miR-510	CLIP-seq
MIRT1055406	hsa-miR-512-5p	CLIP-seq
MIRT1055378	hsa-miR-3160-3p	CLIP-seq
MIRT1055393	hsa-miR-4487	CLIP-seq
MIRT1055407	hsa-miR-558	CLIP-seq
MIRT1055388	hsa-miR-4433	CLIP-seq
MIRT1055390	hsa-miR-4459	CLIP-seq
MIRT1055375	hsa-miR-1908	CLIP-seq
MIRT1055376	hsa-miR-2114	CLIP-seq
MIRT1055377	hsa-miR-3122	CLIP-seq
MIRT1055378	hsa-miR-3160-3p	CLIP-seq
MIRT1055381	hsa-miR-3664-3p	CLIP-seq
MIRT1055383	hsa-miR-3689a-3p	CLIP-seq
MIRT1055384	hsa-miR-3689c	CLIP-seq
MIRT1055385	hsa-miR-3913-5p	CLIP-seq
MIRT1055386	hsa-miR-3929	CLIP-seq
MIRT1055387	hsa-miR-4419b	CLIP-seq
MIRT1055388	hsa-miR-4433	CLIP-seq
MIRT1055389	hsa-miR-4455	CLIP-seq
MIRT1055390	hsa-miR-4459	CLIP-seq
MIRT1055391	hsa-miR-4478	CLIP-seq
MIRT1055393	hsa-miR-4487	CLIP-seq
MIRT1055396	hsa-miR-4695-5p	CLIP-seq
MIRT1055397	hsa-miR-4728-5p	CLIP-seq
MIRT1055399	hsa-miR-4767	CLIP-seq
MIRT1055401	hsa-miR-4793-3p	CLIP-seq
MIRT1055402	hsa-miR-485-5p	CLIP-seq
MIRT1055403	hsa-miR-487a	CLIP-seq
MIRT1055404	hsa-miR-508-5p	CLIP-seq
MIRT1055405	hsa-miR-510	CLIP-seq
MIRT1055406	hsa-miR-512-5p	CLIP-seq
MIRT1055407	hsa-miR-558	CLIP-seq
MIRT1055408	hsa-miR-566	CLIP-seq
MIRT1055410	hsa-miR-663	CLIP-seq
MIRT1055411	hsa-miR-766	CLIP-seq
MIRT1055381	hsa-miR-3664-3p	CLIP-seq
MIRT1055386	hsa-miR-3929	CLIP-seq
MIRT1055387	hsa-miR-4419b	CLIP-seq
MIRT1055388	hsa-miR-4433	CLIP-seq
MIRT1055390	hsa-miR-4459	CLIP-seq
MIRT1055391	hsa-miR-4478	CLIP-seq
MIRT1055396	hsa-miR-4695-5p	CLIP-seq
MIRT1055402	hsa-miR-485-5p	CLIP-seq
MIRT1055405	hsa-miR-510	CLIP-seq
MIRT1055406	hsa-miR-512-5p	CLIP-seq
MIRT1055373	hsa-miR-100	CLIP-seq
MIRT2451409	hsa-miR-1228	CLIP-seq
MIRT1055374	hsa-miR-1283	CLIP-seq
MIRT1055375	hsa-miR-1908	CLIP-seq
MIRT1055377	hsa-miR-3122	CLIP-seq
MIRT1055380	hsa-miR-3613-3p	CLIP-seq
MIRT1055383	hsa-miR-3689a-3p	CLIP-seq
MIRT1055384	hsa-miR-3689c	CLIP-seq
MIRT1055385	hsa-miR-3913-5p	CLIP-seq
MIRT1055389	hsa-miR-4455	CLIP-seq
MIRT1055395	hsa-miR-4684-5p	CLIP-seq
MIRT1055397	hsa-miR-4728-5p	CLIP-seq
MIRT1055398	hsa-miR-4736	CLIP-seq
MIRT1055399	hsa-miR-4767	CLIP-seq
MIRT1055410	hsa-miR-663	CLIP-seq
MIRT1055412	hsa-miR-99a	CLIP-seq
MIRT1055413	hsa-miR-99b	CLIP-seq
MIRT1055373	hsa-miR-100	CLIP-seq
MIRT2451409	hsa-miR-1228	CLIP-seq
MIRT1055374	hsa-miR-1283	CLIP-seq
MIRT1055375	hsa-miR-1908	CLIP-seq
MIRT1055377	hsa-miR-3122	CLIP-seq
MIRT1055379	hsa-miR-3165	CLIP-seq
MIRT1055380	hsa-miR-3613-3p	CLIP-seq
MIRT1055382	hsa-miR-3665	CLIP-seq
MIRT1055383	hsa-miR-3689a-3p	CLIP-seq
MIRT1055384	hsa-miR-3689c	CLIP-seq
MIRT1055385	hsa-miR-3913-5p	CLIP-seq
MIRT1055389	hsa-miR-4455	CLIP-seq
MIRT1055395	hsa-miR-4684-5p	CLIP-seq
MIRT1055397	hsa-miR-4728-5p	CLIP-seq
MIRT1055398	hsa-miR-4736	CLIP-seq
MIRT1055399	hsa-miR-4767	CLIP-seq
MIRT1055408	hsa-miR-566	CLIP-seq
MIRT1055410	hsa-miR-663	CLIP-seq
MIRT1055412	hsa-miR-99a	CLIP-seq
MIRT1055413	hsa-miR-99b	CLIP-seq
MIRT1055373	hsa-miR-100	CLIP-seq
MIRT2451409	hsa-miR-1228	CLIP-seq
MIRT1055374	hsa-miR-1283	CLIP-seq
MIRT1055375	hsa-miR-1908	CLIP-seq
MIRT1055377	hsa-miR-3122	CLIP-seq
MIRT1055379	hsa-miR-3165	CLIP-seq
MIRT1055380	hsa-miR-3613-3p	CLIP-seq
MIRT1055382	hsa-miR-3665	CLIP-seq
MIRT1055383	hsa-miR-3689a-3p	CLIP-seq
MIRT1055384	hsa-miR-3689c	CLIP-seq
MIRT1055385	hsa-miR-3913-5p	CLIP-seq
MIRT1055388	hsa-miR-4433	CLIP-seq
MIRT1055389	hsa-miR-4455	CLIP-seq
MIRT1055390	hsa-miR-4459	CLIP-seq
MIRT1055394	hsa-miR-4683	CLIP-seq
MIRT1055395	hsa-miR-4684-5p	CLIP-seq
MIRT1055397	hsa-miR-4728-5p	CLIP-seq
MIRT1055398	hsa-miR-4736	CLIP-seq
MIRT1055399	hsa-miR-4767	CLIP-seq
MIRT1055400	hsa-miR-4786-5p	CLIP-seq
MIRT1055408	hsa-miR-566	CLIP-seq
MIRT1055410	hsa-miR-663	CLIP-seq
MIRT1055412	hsa-miR-99a	CLIP-seq
MIRT1055413	hsa-miR-99b	CLIP-seq

Show/Hide all (14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004303	Function	Estradiol 17-beta-dehydrogenase [NAD(P)+] activity	IEA
GO:0004745	Function	All-trans-retinol dehydrogenase (NAD+) activity	IEA
GO:0005515	Function	Protein binding	IPI	28514442, 32296183, 33961781
GO:0005737	Component	Cytoplasm	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005811	Component	Lipid droplet	IBA
GO:0005811	Component	Lipid droplet	IDA	25028495
GO:0005811	Component	Lipid droplet	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0016229	Function	Steroid dehydrogenase activity	IBA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016616	Function	Oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor	IBA
GO:0046889	Process	Positive regulation of lipid biosynthetic process	IDA	25028495

MIM	HGNC	e!Ensembl
612127	18685	ENSG00000170509

Q7Z5P4

Protein name

17-beta-hydroxysteroid dehydrogenase 13 (17-beta-HSD 13) (EC 1.1.1.-) (EC 1.1.1.62) (Hepatic retinol/retinal dehydrogenase) (EC 1.1.1.105) (Short chain dehydrogenase/reductase family 16C member 3) (Short-chain dehydrogenase/reductase 9)

Protein function

Plays a pivotal role in hepatic lipid metabolism (PubMed:29562163). In vitro, it catalyzes the oxidation of a variety of lipid substrates, including 17beta-estradiol, retinol, retinal, and leukotriene B4 (PubMed:29562163, PubMed:30415504, PubMed

PDB

8G9V

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00106	adh_short	37 → 233	short chain dehydrogenase	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in the liver (PubMed:29562163). Also detected in ovary, bone marrow, kidney, brain, lung, skeletal muscle, bladder and testis. {ECO:0000269|PubMed:17311113, ECO:0000269|PubMed:29562163}.

Sequence

MNIILEILLLLITIIYSYLESLVKFFIPQRRKSVAGEIVLITGAGHGIGRQTTYEFAKRQ
SILVLWDINKRGVEETAAECRKLGVTAHAYVVDCSNREEIYRSLNQVKKEVGDVTIVVNN
AGTVYPADLLSTKDEEITKTFEVNILGHFWITKALLPSMMERNHGHIVTVASVCGHEGIP
YLIPYCSSKFAAVGFHRGLTSELQALGKTGIKTSCLCPVFVNTGFTKNPSTRLWPVLETD
EVVRSLIDGILTNKKMIFVPSYINIFLRLQKFLPERASAILNRMQNIQFEAVVGHKIKMK

Sequence length

300

Interactions

View interactions

	Reactome
			Lipid particle organization

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CIRRHOSIS OF LIVER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER DISEASE, PROTECTION AGAINST	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HSD17B13 POLYMORPHISM	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC STEATOHEPATITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (42)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Adrenoleukodystrophy	Associate	31967400	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alcoholism	Associate	31630428, 32973038	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ascites	Associate	36233142	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	10574257, 10755407	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Associate	30628708, 34902334, 37644826	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	30628708, 31630428, 32973038, 34902334, 37644826	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Inhibit	31630428	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Associate	37644826	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chemical and Drug Induced Liver Injury	Associate	30323112, 33024398, 33618508	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	10945506	★★★★★ ★☆☆☆☆ Found in Text Mining only
Death	Associate	36233142	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Associate	34506332, 34656649	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Associate	33024398, 34506332, 35411667, 35620859, 37105232, 37644826, 37794183, 39596570	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Alcoholic	Associate	33618508	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis	Associate	29562163, 30323112, 31630428, 31815349, 31967400, 32161197, 32720691, 32841307, 32973038, 34656649, 36233142, 36924053	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis	Inhibit	31630428	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Associate	34505421	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Associate	31967400, 36233142	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatic Encephalopathy	Associate	36233142	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis Alcoholic	Associate	33616244	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Associate	37644826	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension Portal	Associate	31967400	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ichthyosis prematurity syndrome	Associate	32865200	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Noncirrhotic Portal Hypertension	Associate	36233142	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	30415504, 32161197, 35411667	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammation	Inhibit	35411667	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Associate	31517326, 33975381	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Alcoholic	Associate	29562163	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases	Associate	29562163, 30323112, 31517326, 32161197, 32973038, 34261618, 36233142, 36555467, 37686209	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases	Inhibit	32443539	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases Alcoholic	Inhibit	29562163, 31630428	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases Alcoholic	Associate	29562163, 30589442, 31630428	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Associate	29562163, 31967400, 33618508, 33975381, 36555467, 36924053	★★★★★ ★☆☆☆☆ Found in Text Mining only
Menopause Premature	Associate	24855493	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	14979917, 24077358, 33618508	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non alcoholic Fatty Liver Disease	Associate	29562163, 30323112, 30415504, 31967400, 32161197, 32349377, 32841307, 32973038, 33024398, 33618508, 33704100, 33922278, 34076851, 34506332, 34558842 View all (4 more)	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Associate	33024398, 34506332	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Associate	17454161	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Associate	25336708	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Associate	19298523	★★★★★ ★☆☆☆☆ Found in Text Mining only
Takotsubo Cardiomyopathy	Associate	33618508	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Associate	27571989	★★★★★ ★☆☆☆☆ Found in Text Mining only

HSD17B13 (hydroxysteroid 17-beta dehydrogenase 13)