Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
345274
Gene name Gene Name - the full gene name approved by the HGNC.
Solute carrier family 10 member 6
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SLC10A6
Synonyms (NCBI Gene) Gene synonyms aliases
SOAT
Chromosome Chromosome number
4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
4q21.3
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT699495 hsa-miR-302f HITS-CLIP 23313552
MIRT699494 hsa-miR-6808-5p HITS-CLIP 23313552
MIRT699493 hsa-miR-6893-5p HITS-CLIP 23313552
MIRT699492 hsa-miR-940 HITS-CLIP 23313552
MIRT699491 hsa-miR-4768-3p HITS-CLIP 23313552
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005886 Component Plasma membrane TAS
GO:0006811 Process Monoatomic ion transport IEA
GO:0006814 Process Sodium ion transport IEA
GO:0006869 Process Lipid transport IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
613366 30603 ENSG00000145283
Protein
UniProt ID Q3KNW5
Protein name Sodium-dependent organic anion transporter (SOAT) (Solute carrier family 10 member 6) (SLC10A6)
Protein function Transports sulfoconjugated steroid hormones from the extracellular compartment into the cytosol in a sodium-dependent manner without hydrolysis (PubMed:17491011, PubMed:23667501, PubMed:24717977, PubMed:28951227). Steroid sulfate hormones are co
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01758 SBF 39 217 Sodium Bile acid symporter family Family
Tissue specificity TISSUE SPECIFICITY: Highly expressed in testis, placenta and pancreas. Moderately expressed in heart, lung and mammary gland. Weakly expressed in brain, colon, kidney, liver, ovary, prostate, small intestine, spleen and thymus. {ECO:0000269|PubMed:1749101
Sequence
MRANCSSSSACPANSSEEELPVGLEVHGNLELVFTVVSTVMMGLLMFSLGCSVEIRKLWS
HIRRPWGIAVGLLCQFGLMPFTAYLLAISFSLKPVQAIAVLIMGCCPGGTISNIFTFWVD
GDMDLSISMTTCSTVAALGMMPLCIYLYTWSWSLQQNLTIPYQNIGITLVCLTIPVAFGV
YVNYRWPKQSKIILKIGAVVGGVLLLVVAVAGVVLAK
GSWNSDITLLTISFIFPLIGHVT
GFLLALFTHQSWQRCRTISLETGAQNIQMCITMLQLSFTAEHLVQMLSFPLAYGLFQLID
GFLIVAAYQTYKRRLKNKHGKKNSGCTEVCHTRKSTSSRETNAFLEVNEEGAITPGPPGP
MDCHRALEPVGHITSCE
Sequence length 377
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Transport of bile salts and organic acids, metal ions and amine compounds
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Carcinoma Renal Cell Associate 36059531
Oligospermia Inhibit 23667501