Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3451
Gene name	Interferon alpha 17
Gene symbol	IFNA17
Synonyms (NCBI Gene)	IFN-alphaIIFNAINFALEIF2C1
Chromosome	9
Chromosome location	9p21.3

Show/Hide all (2)

miRTarBase ID	miRNA	Experiments	Reference
MIRT1060628	hsa-miR-3121-3p	CLIP-seq
MIRT1060629	hsa-miR-3913-3p	CLIP-seq

Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002250	Process	Adaptive immune response	IBA
GO:0002286	Process	T cell activation involved in immune response	IBA
GO:0002312	Process	B cell activation involved in immune response	IBA
GO:0002323	Process	Natural killer cell activation involved in immune response	IBA
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IEA
GO:0005126	Function	Cytokine receptor binding	IEA
GO:0005132	Function	Type I interferon receptor binding	IBA
GO:0005132	Function	Type I interferon receptor binding	TAS	3891272
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0006952	Process	Defense response	IEA
GO:0006959	Process	Humoral immune response	IBA
GO:0009615	Process	Response to virus	TAS	3891272
GO:0043330	Process	Response to exogenous dsRNA	IBA
GO:0051607	Process	Defense response to virus	IEA
GO:0060337	Process	Type I interferon-mediated signaling pathway	IBA
GO:0060337	Process	Type I interferon-mediated signaling pathway	NAS	30936491
GO:0098586	Process	Cellular response to virus	NAS	30936491

MIM	HGNC	e!Ensembl
147583	5422	ENSG00000234829

P01571

Protein name

Interferon alpha-17 (IFN-alpha-17) (Interferon alpha-88) (Interferon alpha-I') (LeIF I) (Interferon alpha-T)

Protein function

Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00143	Interferon	26 → 185	Interferon alpha/beta domain	Domain

Sequence

MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFG
LPQEEFDGNQFQKTQAISVLHEMIQQTFNLFSTEDSSAAWEQSLLEKFSTELYQQLNNLE
ACVIQEVGMEETPLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSLSFSTN
LQKILRRKD

Sequence length

189

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction PI3K-Akt signaling pathway Necroptosis Toll-like receptor signaling pathway NOD-like receptor signaling pathway RIG-I-like receptor signaling pathway Cytosolic DNA-sensing pathway JAK-STAT signaling pathway Natural killer cell mediated cytotoxicity Alcoholic liver disease Tuberculosis Hepatitis C Hepatitis B Measles Human cytomegalovirus infection Influenza A Human papillomavirus infection Kaposi sarcoma-associated herpesvirus infection Herpes simplex virus 1 infection Epstein-Barr virus infection Human immunodeficiency virus 1 infection Coronavirus disease - COVID-19 Pathways in cancer Autoimmune thyroid disease Lipid and atherosclerosis		Interferon alpha/beta signaling Regulation of IFNA signaling TRAF6 mediated IRF7 activation Factors involved in megakaryocyte development and platelet production

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
HEMORRHAGIC FEVER, CRIMEAN	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SARCOIDOSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (13)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Brain Neoplasms	Associate	31729458	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Associate	38615592	★★★★★ ★☆☆☆☆ Found in Text Mining only
Erdheim Chester Disease	Inhibit	37335698	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Stimulate	38615592	★★★★★ ★☆☆☆☆ Found in Text Mining only
Infections	Stimulate	38101522	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	26202481, 29800615, 30536330, 37232357	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Associate	9219533	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	32431053, 8751858	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nevus Epithelioid and Spindle Cell	Associate	32431053	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Stimulate	20808670	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	37142586	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sepsis Associated Encephalopathy	Associate	39966958	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vulvar Neoplasms	Associate	9067409	★★★★★ ★☆☆☆☆ Found in Text Mining only

IFNA17 (interferon alpha 17)