Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	345
Gene name	Apolipoprotein C3
Gene symbol	APOC3
Synonyms (NCBI Gene)	APOCIIIApo-C3ApoC-3
Chromosome	11
Chromosome location	11q23.3
Summary	This gene encodes a protein component of triglyceride (TG)-rich lipoproteins (TRLs) including very low density lipoproteins (VLDL), high density lipoproteins (HDL) and chylomicrons. The encoded protein plays a role in role in the metabolism of these TRLs

Show/Hide all (6)

SNP ID	Visualize variation	Clinical significance	Consequence
rs76353203	C>G,T	Pathogenic, protective	Missense variant, coding sequence variant, stop gained
rs121918381	A>G	Pathogenic	Coding sequence variant, missense variant
rs121918382	A>G	Pathogenic	Coding sequence variant, missense variant
rs138326449	G>A	Protective, pathogenic	Splice donor variant
rs140621530	G>T	Protective, likely-benign, pathogenic	Splice donor variant
rs147210663	G>A,T	Protective, pathogenic	Missense variant, coding sequence variant

105

Show/Hide all (105)

miRTarBase ID	miRNA	Experiments	Reference
MIRT696694	hsa-miR-548c-3p	HITS-CLIP	23313552
MIRT696692	hsa-miR-6732-3p	HITS-CLIP	23313552
MIRT696693	hsa-miR-5583-3p	HITS-CLIP	23313552
MIRT696691	hsa-miR-34a-3p	HITS-CLIP	23313552
MIRT696690	hsa-miR-10a-5p	HITS-CLIP	23313552
MIRT696689	hsa-miR-10b-5p	HITS-CLIP	23313552
MIRT696688	hsa-miR-3613-3p	HITS-CLIP	23313552
MIRT542480	hsa-miR-6849-3p	HITS-CLIP	23313552
MIRT696687	hsa-miR-339-5p	HITS-CLIP	23313552
MIRT696686	hsa-miR-4421	HITS-CLIP	23313552
MIRT696685	hsa-miR-5699-3p	HITS-CLIP	23313552
MIRT696684	hsa-miR-3190-5p	HITS-CLIP	23313552
MIRT696683	hsa-miR-4786-5p	HITS-CLIP	23313552
MIRT696682	hsa-miR-769-5p	HITS-CLIP	23313552
MIRT696681	hsa-miR-3926	HITS-CLIP	23313552
MIRT696680	hsa-miR-6895-3p	HITS-CLIP	23313552
MIRT696679	hsa-miR-593-3p	HITS-CLIP	23313552
MIRT696678	hsa-miR-4684-5p	HITS-CLIP	23313552
MIRT696677	hsa-miR-3672	HITS-CLIP	23313552
MIRT696676	hsa-miR-6864-3p	HITS-CLIP	23313552
MIRT696675	hsa-miR-548s	HITS-CLIP	23313552
MIRT696674	hsa-miR-6818-3p	HITS-CLIP	23313552
MIRT542483	hsa-miR-4432	PAR-CLIP	21572407
MIRT542482	hsa-miR-508-5p	PAR-CLIP	21572407
MIRT542481	hsa-miR-451b	PAR-CLIP	21572407
MIRT542480	hsa-miR-6849-3p	PAR-CLIP	21572407
MIRT542478	hsa-miR-4267	PAR-CLIP	21572407
MIRT542479	hsa-miR-939-3p	PAR-CLIP	21572407
MIRT542477	hsa-miR-766-3p	PAR-CLIP	21572407
MIRT542476	hsa-miR-4793-3p	PAR-CLIP	21572407
MIRT542475	hsa-miR-4486	PAR-CLIP	21572407
MIRT542474	hsa-miR-4696	PAR-CLIP	21572407
MIRT542473	hsa-miR-661	PAR-CLIP	21572407
MIRT542472	hsa-miR-4649-5p	PAR-CLIP	21572407
MIRT542471	hsa-miR-6729-5p	PAR-CLIP	21572407
MIRT542470	hsa-miR-6512-3p	PAR-CLIP	21572407
MIRT542469	hsa-miR-6720-5p	PAR-CLIP	21572407
MIRT542468	hsa-miR-7703	PAR-CLIP	21572407
MIRT542478	hsa-miR-4267	PAR-CLIP	27292025
MIRT542483	hsa-miR-4432	PAR-CLIP	27292025
MIRT542483	hsa-miR-4432	PAR-CLIP	27292025
MIRT542475	hsa-miR-4486	PAR-CLIP	27292025
MIRT542475	hsa-miR-4486	PAR-CLIP	27292025
MIRT542481	hsa-miR-451b	PAR-CLIP	27292025
MIRT542481	hsa-miR-451b	PAR-CLIP	27292025
MIRT542472	hsa-miR-4649-5p	PAR-CLIP	27292025
MIRT542472	hsa-miR-4649-5p	PAR-CLIP	27292025
MIRT542474	hsa-miR-4696	PAR-CLIP	27292025
MIRT542474	hsa-miR-4696	PAR-CLIP	27292025
MIRT542476	hsa-miR-4793-3p	PAR-CLIP	27292025
MIRT542476	hsa-miR-4793-3p	PAR-CLIP	27292025
MIRT542482	hsa-miR-508-5p	PAR-CLIP	27292025
MIRT542482	hsa-miR-508-5p	PAR-CLIP	27292025
MIRT542470	hsa-miR-6512-3p	PAR-CLIP	27292025
MIRT542470	hsa-miR-6512-3p	PAR-CLIP	27292025
MIRT542473	hsa-miR-661	PAR-CLIP	27292025
MIRT542473	hsa-miR-661	PAR-CLIP	27292025
MIRT542469	hsa-miR-6720-5p	PAR-CLIP	27292025
MIRT542469	hsa-miR-6720-5p	PAR-CLIP	27292025
MIRT542471	hsa-miR-6729-5p	PAR-CLIP	27292025
MIRT542471	hsa-miR-6729-5p	PAR-CLIP	27292025
MIRT542477	hsa-miR-766-3p	PAR-CLIP	27292025
MIRT542477	hsa-miR-766-3p	PAR-CLIP	27292025
MIRT542468	hsa-miR-7703	PAR-CLIP	27292025
MIRT542468	hsa-miR-7703	PAR-CLIP	27292025
MIRT542479	hsa-miR-939-3p	PAR-CLIP	27292025
MIRT542479	hsa-miR-939-3p	PAR-CLIP	27292025
MIRT696694	hsa-miR-548c-3p	HITS-CLIP	23313552
MIRT696692	hsa-miR-6732-3p	HITS-CLIP	23313552
MIRT696693	hsa-miR-5583-3p	HITS-CLIP	23313552
MIRT696691	hsa-miR-34a-3p	HITS-CLIP	23313552
MIRT696690	hsa-miR-10a-5p	HITS-CLIP	23313552
MIRT696689	hsa-miR-10b-5p	HITS-CLIP	23313552
MIRT696688	hsa-miR-3613-3p	HITS-CLIP	23313552
MIRT542480	hsa-miR-6849-3p	HITS-CLIP	23313552
MIRT696687	hsa-miR-339-5p	HITS-CLIP	23313552
MIRT696686	hsa-miR-4421	HITS-CLIP	23313552
MIRT696685	hsa-miR-5699-3p	HITS-CLIP	23313552
MIRT696684	hsa-miR-3190-5p	HITS-CLIP	23313552
MIRT696683	hsa-miR-4786-5p	HITS-CLIP	23313552
MIRT696682	hsa-miR-769-5p	HITS-CLIP	23313552
MIRT696681	hsa-miR-3926	HITS-CLIP	23313552
MIRT696680	hsa-miR-6895-3p	HITS-CLIP	23313552
MIRT696679	hsa-miR-593-3p	HITS-CLIP	23313552
MIRT696678	hsa-miR-4684-5p	HITS-CLIP	23313552
MIRT696677	hsa-miR-3672	HITS-CLIP	23313552
MIRT696676	hsa-miR-6864-3p	HITS-CLIP	23313552
MIRT696675	hsa-miR-548s	HITS-CLIP	23313552
MIRT696674	hsa-miR-6818-3p	HITS-CLIP	23313552
MIRT542483	hsa-miR-4432	PAR-CLIP	21572407
MIRT542482	hsa-miR-508-5p	PAR-CLIP	21572407
MIRT542481	hsa-miR-451b	PAR-CLIP	21572407
MIRT542480	hsa-miR-6849-3p	PAR-CLIP	21572407
MIRT542478	hsa-miR-4267	PAR-CLIP	21572407
MIRT542479	hsa-miR-939-3p	PAR-CLIP	21572407
MIRT542477	hsa-miR-766-3p	PAR-CLIP	21572407
MIRT542476	hsa-miR-4793-3p	PAR-CLIP	21572407
MIRT542475	hsa-miR-4486	PAR-CLIP	21572407
MIRT542474	hsa-miR-4696	PAR-CLIP	21572407
MIRT542473	hsa-miR-661	PAR-CLIP	21572407
MIRT542472	hsa-miR-4649-5p	PAR-CLIP	21572407
MIRT542471	hsa-miR-6729-5p	PAR-CLIP	21572407
MIRT542470	hsa-miR-6512-3p	PAR-CLIP	21572407
MIRT542469	hsa-miR-6720-5p	PAR-CLIP	21572407
MIRT542468	hsa-miR-7703	PAR-CLIP	21572407

Show/Hide all (14)

Transcription factor	Regulation	Reference
ATF2	Activation	9760243
HDAC1	Unknown	20516075
HDAC3	Unknown	20516075
HNF4A	Unknown	1639815;20516075
JUN	Activation	9760243
NR0B2	Unknown	20516075
NR2F1	Unknown	1639815
NR2F6	Unknown	1639815
PPARA	Repression	10494028
PPARA	Unknown	11007963
PPARGC1A	Activation	16891307
SMAD3	Activation	10995777
SMAD4	Activation	10995777
SP1	Unknown	7640286

Show/Hide all (58)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005543	Function	Phospholipid binding	IBA
GO:0005543	Function	Phospholipid binding	IDA	4066713, 11060345
GO:0005576	Component	Extracellular region	HDA	27068509, 27559042
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IDA	11060345
GO:0005769	Component	Early endosome	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006641	Process	Triglyceride metabolic process	IMP	17142127
GO:0006869	Process	Lipid transport	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	16443932
GO:0008289	Function	Lipid binding	IEA
GO:0010897	Process	Negative regulation of triglyceride catabolic process	IBA
GO:0010897	Process	Negative regulation of triglyceride catabolic process	IDA	3973011, 18635818
GO:0010903	Process	Negative regulation of very-low-density lipoprotein particle remodeling	IDA	3973011, 18635818
GO:0010916	Process	Negative regulation of very-low-density lipoprotein particle clearance	IBA
GO:0010916	Process	Negative regulation of very-low-density lipoprotein particle clearance	IDA	1917954
GO:0010987	Process	Negative regulation of high-density lipoprotein particle clearance	IBA
GO:0010987	Process	Negative regulation of high-density lipoprotein particle clearance	IMP	15778093
GO:0010989	Process	Negative regulation of low-density lipoprotein particle clearance	IBA
GO:0010989	Process	Negative regulation of low-density lipoprotein particle clearance	IMP	15778093
GO:0015485	Function	Cholesterol binding	IC	11162594
GO:0016042	Process	Lipid catabolic process	IEA
GO:0019433	Process	Triglyceride catabolic process	IBA
GO:0019433	Process	Triglyceride catabolic process	IDA	11060345
GO:0032489	Process	Regulation of Cdc42 protein signal transduction	IDA	16443932
GO:0033344	Process	Cholesterol efflux	IDA	11162594, 16443932
GO:0033700	Process	Phospholipid efflux	IDA	11162594
GO:0034361	Component	Very-low-density lipoprotein particle	IBA
GO:0034361	Component	Very-low-density lipoprotein particle	IDA	3973011, 16935699, 17154273
GO:0034361	Component	Very-low-density lipoprotein particle	IEA
GO:0034363	Component	Intermediate-density lipoprotein particle	IBA
GO:0034363	Component	Intermediate-density lipoprotein particle	IDA	17336988
GO:0034366	Component	Spherical high-density lipoprotein particle	IBA
GO:0034366	Component	Spherical high-density lipoprotein particle	IDA	17438339
GO:0034375	Process	High-density lipoprotein particle remodeling	IMP	17438339
GO:0034379	Process	Very-low-density lipoprotein particle assembly	TAS	18399797
GO:0034382	Process	Chylomicron remnant clearance	IDA	4020294
GO:0042157	Process	Lipoprotein metabolic process	IEA
GO:0042627	Component	Chylomicron	IBA
GO:0042627	Component	Chylomicron	IDA	8245722
GO:0042627	Component	Chylomicron	IEA
GO:0042632	Process	Cholesterol homeostasis	IBA
GO:0042632	Process	Cholesterol homeostasis	IMP	18767813
GO:0043691	Process	Reverse cholesterol transport	IC	17438339
GO:0045717	Process	Negative regulation of fatty acid biosynthetic process	IDA	11060345, 18635818
GO:0045833	Process	Negative regulation of lipid metabolic process	IDA	182536
GO:0048261	Process	Negative regulation of receptor-mediated endocytosis	IDA	1917954
GO:0050995	Process	Negative regulation of lipid catabolic process	IDA	15576844
GO:0055102	Function	Lipase inhibitor activity	IBA
GO:0055102	Function	Lipase inhibitor activity	IDA	182536, 3973011, 11060345, 15576844, 18635818
GO:0060621	Process	Negative regulation of cholesterol import	IMP	15778093
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0070328	Process	Triglyceride homeostasis	IBA
GO:0070328	Process	Triglyceride homeostasis	IMP	18767813
GO:0070653	Function	High-density lipoprotein particle receptor binding	IBA
GO:0070653	Function	High-density lipoprotein particle receptor binding	IPI	9254056

MIM	HGNC	e!Ensembl
107720	610	ENSG00000110245

P02656

Protein name

Apolipoprotein C-III (Apo-CIII) (ApoC-III) (Apolipoprotein C3)

Protein function

Component of triglyceride-rich very low density lipoproteins (VLDL) and high density lipoproteins (HDL) in plasma (PubMed:18201179, PubMed:22510806). Plays a multifaceted role in triglyceride homeostasis (PubMed:18201179, PubMed:22510806). Intra

PDB

2JQ3

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05778	Apo-CIII	22 → 90	Apolipoprotein CIII (Apo-CIII)	Family

Tissue specificity

TISSUE SPECIFICITY: Liver. {ECO:0000269|PubMed:6328445}.

Sequence

MQPRVLLVVALLALLASARASEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQAR
GWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA

Sequence length

Interactions

View interactions

	KEGG		Reactome
	PPAR signaling pathway Cholesterol metabolism		Chylomicron assembly Chylomicron remodeling HDL remodeling Retinoid metabolism and transport

Show/Hide Causal Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Apolipoprotein c-III deficiency	Pathogenic	rs121918382	RCV000019492
Apolipoprotein C-III, nonglycosylated	Pathogenic	rs121918381	RCV000019491

Show/Hide Unknown Diseases (8)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
APOC3-related disorder	Benign; Likely benign	rs200557528	RCV003941127
Cardiovascular phenotype	Benign; Likely benign; Conflicting classifications of pathogenicity; Uncertain significance	rs200557528, rs138326449, rs147210663, rs764157867, rs571476926, rs762766868, rs774247573, rs942960138, rs963060587, rs1941437848, rs1204077086, rs372158089, rs2540278122, rs1591326474, rs1179268663 View all (16 more)	RCV002386559 RCV002345442 RCV002371975 RCV006357431 RCV002323323 RCV002357797 RCV002340620 RCV002351343 RCV002367356 RCV002376355 RCV002367141 RCV002364746 RCV002399045 RCV002407404 RCV002410872 RCV002450321 RCV002435114 RCV002437890 RCV004089301 RCV003177262 RCV003177263 RCV003214123 RCV003310166 RCV004320105 RCV003301913 RCV003301915 RCV005467945 RCV004984647 RCV004518670 RCV002385955 RCV002375311
Cervical cancer	Conflicting classifications of pathogenicity	rs140621530	RCV005886891
Cholesterol-ester transfer protein deficiency	Conflicting classifications of pathogenicity	rs76353203	RCV005357152
Clear cell carcinoma of kidney	Conflicting classifications of pathogenicity	rs138326449	RCV005886890
Coronary heart disease	Conflicting classifications of pathogenicity	rs138326449, rs147210663, rs140621530, rs76353203	RCV000128449 RCV000128450 RCV000128451 RCV000128448
Hepatocellular carcinoma	Benign; Likely benign	rs200557528	RCV005922435
Myocardial infarction, susceptibility to	Benign	rs5128	RCV002259396

Show/Hide Text Mining Associations (126)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Acute Coronary Syndrome	Associate	22675253
Alcohol Related Disorders	Associate	37902017
Alzheimer Disease	Inhibit	26491253
Alzheimer Disease	Associate	35387811
Amyloidosis	Associate	26790392
Amyloidosis Familial	Associate	26790392
Anemia Sickle Cell	Associate	11553004
Antiphospholipid Syndrome	Associate	32299226
Aphasia Conduction	Associate	40065360
Apolipoprotein C III Deficiency	Associate	26790392
Atherosclerosis	Associate	20002542, 22236405, 25363704, 29162127, 2989400, 3118360, 31852220, 36768547, 37114828, 9691099
Atherosclerosis	Stimulate	33580780, 40282372
Atherosclerosis	Inhibit	38127052
Atrial Fibrillation	Associate	32197906
Brain Ischemia	Associate	22532455
Breast Neoplasms	Associate	40715365
Carcinoma Hepatocellular	Associate	1312668, 31136099, 36091935, 40282372
Carcinoma Hepatocellular	Stimulate	22726459
Cardiovascular Diseases	Associate	12118856, 16602826, 20002542, 22236405, 24941082, 26117401, 26255783, 26824674, 27624799, 28948955, 29212317, 31345219, 32174066, 32710763, 36040803 View all (4 more)
Cardiovascular Diseases	Stimulate	27619170
Celiac Disease	Associate	20454521, 21378598
Cerebral Arterial Diseases	Associate	26824674
Cerebral Hemorrhage	Associate	25994187
Cerebral Infarction	Associate	28635360
Chronic Pain	Inhibit	31649376
Chronobiology Disorders	Associate	19424489
Cognition Disorders	Associate	19424489
Cognitive Dysfunction	Stimulate	35387811
Colitis Ulcerative	Inhibit	38287401
Colorectal Neoplasms	Associate	30542696
Congenital Disorders of Glycosylation	Associate	29869806
Coronary Artery Disease	Associate	12235176, 12964943, 14563827, 16769999, 19074352, 20002542, 24242684, 25380998, 26069232, 28473441, 32710763, 34548093, 8728325
Coronary Artery Disease	Stimulate	20307520
Coronary Disease	Associate	11483625, 12576526, 24941081, 25185943, 26387083, 27114411, 27624799, 32437778, 36691918
Coronary Disease	Stimulate	26069232
Coronary Restenosis	Associate	12704570
COVID 19	Associate	34232570
Cryoglobulinemia	Stimulate	35677050
Depressive Disorder	Associate	26491253
Diabetes Complications	Associate	32665614
Diabetes Mellitus	Associate	17197160, 19424489
Diabetes Mellitus Type 1	Associate	21373834
Diabetes Mellitus Type 2	Associate	17197160, 21373834, 26945091, 37834292
Drug Hypersensitivity	Associate	24972136
Dyslipidemias	Associate	16417409, 18566295, 21939545, 22236405, 22566642, 28610615, 31856839, 36759651
Elejalde Disease	Stimulate	38143756
Enterocolitis Necrotizing	Associate	36371157
Fabry Disease	Associate	38395389
Fatty Liver	Associate	22105854
Fatty Liver Alcoholic	Associate	23512881, 26845607
Glaucoma Open Angle	Associate	29847670
Gout	Inhibit	27094595
Gout	Associate	27094595
Guillain Barre Syndrome	Stimulate	38143756
Hairy palms and soles	Associate	3118360
Hemolytic Uremic Syndrome	Associate	10412780, 26790392
Hemorrhage	Associate	22532455
Hemorrhagic Fever with Renal Syndrome	Stimulate	20797315
Hernia	Associate	23631828
HIV Infections	Associate	16417409, 21939545, 22775001, 22848358, 24972136, 33115242
Hypercholesterolemia	Associate	11483625, 22848358
Hyperglycemia	Associate	18541587
Hyperlipidemia Familial Combined	Associate	10064730, 10357835, 11181747, 8100834, 8820109, 9062353, 9215535
Hyperlipidemias	Associate	10357835, 12118856, 15809899, 19034316, 25380998, 26117401, 27619170, 2883893, 9254071
Hyperlipoproteinemia Type I	Associate	25470695, 34678899, 37100699
Hyperlipoproteinemia Type II	Associate	32489792, 9215535
Hyperlipoproteinemia Type III	Associate	19034316
Hyperlipoproteinemia Type V	Associate	10064743
Hypertension	Associate	16602826, 25320541, 30380775
Hypertension Pulmonary	Associate	11282888
Hypertriglyceridemia	Associate	11483625, 12021280, 12118856, 12235176, 12588953, 15809899, 16417409, 16495512, 16861622, 16864937, 17919884, 18096054, 18408013, 18556566, 20335584 View all (16 more)
Hypertriglyceridemia	Stimulate	35568684
Hypertriglyceridemic Waist	Associate	10508207, 11483625, 12588953, 20368524, 2995445, 36921196
Hypertriglyceridemic Waist	Stimulate	36921196
Hypertrophy Left Ventricular	Associate	38395389
Immunologic Deficiency Syndromes	Associate	3118360
Inflammation	Associate	27619170, 32174066, 33294458
Inflammation	Inhibit	29115584
Inflammatory Bowel Diseases	Associate	38287401
Insulin Resistance	Associate	12118856, 20335584, 21274868, 21663607, 25320541, 32323743, 37834292
Insulin Resistance	Stimulate	18556566
Intestinal Neoplasms	Associate	1312668
Kidney Diseases	Associate	32174066
Kidney Failure Chronic	Associate	1614054
Labor Pain	Associate	26824674
Legg Calve Perthes Disease	Associate	26438379
Lipid Metabolism Disorders	Associate	19424489, 24972136
Lipoatrophy with diabetes hepatic steatosis cardiomyopathy and leukomelanodermic papules	Associate	22775001
Lipodystrophy	Associate	22775001
Liver Diseases	Associate	40065360
Metabolic Diseases	Associate	20368524
Metabolic Syndrome	Associate	12697303, 14563827, 16602826, 17416293, 18096054, 18566295, 26824674
Metabolic Syndrome	Stimulate	14563827
Mucositis	Associate	21378598
Myocardial Infarction	Associate	16192625, 18541587
Myocardial Ischemia	Associate	24941082
Neoplasms Adipose Tissue	Associate	21373834
Non alcoholic Fatty Liver Disease	Associate	20335584, 21663607, 25320541, 26646939, 29595690, 33294458, 34089894, 35333773
Obesity	Associate	14563827, 28974732, 31856839, 34043341, 36855114
Obesity Abdominal	Associate	12588953, 18541587
Oliguria	Stimulate	20797315
Osteogenesis imperfecta type 3	Associate	8099442
Overweight	Associate	21373834
Pancreatic Neoplasms	Associate	28514751
Pneumonia Lipid	Associate	15809899, 24972136, 25005712
Polycystic Ovary Syndrome	Associate	31278444, 32323743, 37902017
Polycythemia	Associate	26485402
Prediabetic State	Associate	26945091
Renal Insufficiency	Associate	26790392
Retinal Vein Occlusion	Stimulate	33270842
Retinoblastoma	Associate	31207142
Sialic Acid Storage Disease	Associate	16769205
Small Cell Lung Carcinoma	Associate	26996551
Squamous Cell Carcinoma of Head and Neck	Associate	36361568, 37686462
Stomach Diseases	Stimulate	26485402
Stomach Neoplasms	Associate	21267442, 36430456, 37350375
Stomach Neoplasms	Inhibit	37100457
Stroke	Associate	11553004
Stroke Lacunar	Associate	29115584
Thrombosis	Associate	32299226
Thyroid Cancer Papillary	Associate	19785722
Urinary Bladder Neoplasms	Associate	23631828
Vascular Diseases	Associate	24941082, 36768547
Vascular Diseases	Stimulate	27619170
Ventricular Fibrillation	Associate	26790392
Weight Loss	Inhibit	28391889

APOC3 (apolipoprotein C3)