IFNA5 (interferon alpha 5)

Gene

• Entrez ID: 3442
• Gene name: Interferon alpha 5
• Gene symbol: IFNA5
• Synonyms (NCBI Gene): IFN-alpha-5, IFN-alphaG, INA5, INFA5, leIF G
• Chromosome: 9
• Chromosome location: 9p21.3

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002250	Process	Adaptive immune response	IBA	21873635
GO:0002286	Process	T cell activation involved in immune response	IBA	21873635
GO:0002323	Process	Natural killer cell activation involved in immune response	IBA	21873635
GO:0005125	Function	Cytokine activity	IBA	21873635
GO:0005126	Function	Cytokine receptor binding	TAS	6163083
GO:0005132	Function	Type I interferon receptor binding	IBA	21873635
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0006959	Process	Humoral immune response	IBA	21873635
GO:0007596	Process	Blood coagulation	TAS
GO:0019221	Process	Cytokine-mediated signaling pathway	IBA	21873635
GO:0030183	Process	B cell differentiation	IBA	21873635
GO:0033141	Process	Positive regulation of peptidyl-serine phosphorylation of STAT protein	IBA	21873635
GO:0042100	Process	B cell proliferation	IBA	21873635
GO:0043330	Process	Response to exogenous dsRNA	IBA	21873635
GO:0051607	Process	Defense response to virus	IEA
GO:0060337	Process	Type I interferon signaling pathway	TAS

Other IDs

• MIM: 147565
• HGNC: 5426
• e!Ensembl: ENSG00000147873

Protein

• UniProt ID: P01569
• Protein name: Interferon alpha-5 (IFN-alpha-5) (Interferon alpha-61) (Interferon alpha-G) (LeIF G)
• Protein function: Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00143	Interferon	26 → 185	Interferon alpha/beta domain	Domain

• Sequence:

  MALPFVLLMALVVLNCKSICSLGCDLPQTHSLSNRRTLMIMAQMGRISPFSCLKDRHDFG
  FPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSATWDETLLDKFYTELYQQLNDLE
  ACMMQEVGVEDTPLMNVDSILTVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSAN
  LQERLRRKE

• Sequence length: 189

Pathways

KEGG:

Cytokine-cytokine receptor interaction
PI3K-Akt signaling pathway
Necroptosis
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Cytosolic DNA-sensing pathway
JAK-STAT signaling pathway
Natural killer cell mediated cytotoxicity
Alcoholic liver disease
Tuberculosis
Hepatitis C
Hepatitis B
Measles
Human cytomegalovirus infection
Influenza A
Human papillomavirus infection
Kaposi sarcoma-associated herpesvirus infection
Herpes simplex virus 1 infection
Epstein-Barr virus infection
Human immunodeficiency virus 1 infection
Coronavirus disease - COVID-19
Pathways in cancer
Autoimmune thyroid disease
Lipid and atherosclerosis

Reactome:

Interferon alpha/beta signaling
Regulation of IFNA signaling
TRAF6 mediated IRF7 activation
Factors involved in megakaryocyte development and platelet production

Associated diseases

Causal
Disease term	Disease name	dbSNP ID	References
Melanoma	melanoma	rs121913315, rs121913323, rs137853080, rs137853081, rs121909232, rs121913388, rs104894094, rs104894095, rs104894097, rs104894098, rs104894099, rs104894109, rs137854599, rs11547328, rs104894340, rs398123152, rs587780668, rs587782083, rs587782206, rs587782792, rs180177042, rs121913381, rs730881675, rs730881674, rs730881677, rs730881673, rs1800586, rs768966657, rs587778189, rs786204195, rs121913321, rs45476696, rs864622636, rs864622263, rs869025340, rs876660436, rs876658534, rs876658556, rs878853647, rs878853644, rs878853650, rs886041162, rs121913389, rs1057519852, rs121913384, rs121913387, rs1060501266, rs1060501263, rs1060501262, rs749714198, rs1060501265, rs559848002, rs1064794292, rs1131691187, rs1131691186, rs199907548, rs1554654052, rs1554656411, rs1554656624, rs1554653915, rs1554653956, rs1554656253, rs1554654224, rs754806883, rs1057520039, rs1563889584, rs1563889685, rs1287464120, rs1563888944, rs1563892715, rs1563889847, rs141798398, rs1587332338, rs1587340291, rs11552823, rs561034503, rs138677674, rs1819962958, rs1820531050	16809738
Pancreatic cancer	Malignant neoplasm of pancreas	rs118203998, rs180177143, rs587776417, rs587776527, rs864622498, rs876659571, rs587778587, rs886039619, rs745533713, rs1555460431	15320962

Associations from Text Mining
Disease Name	Relationship Type	References
HIV Infections	Stimulate	29762170
Inflammation	Associate	37381923
Proteinuria	Associate	37445814