Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
343637
Gene name Gene Name - the full gene name approved by the HGNC.
R-spondin 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RSPO4
Synonyms (NCBI Gene) Gene synonyms aliases
C20orf182, CRISTIN4
Chromosome Chromosome number
20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
20p13
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the R-spondin family of proteins that share a common domain organization consisting of a signal peptide, cysteine-rich/furin-like domain, thrombospondin domain and a C-terminal basic region. The encoded protein may be involve
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs74315420 T>C Pathogenic Coding sequence variant, missense variant
rs74315421 A>G Pathogenic Coding sequence variant, missense variant
rs74315422 C>T Pathogenic Coding sequence variant, missense variant
rs74315423 C>G,T Pathogenic Coding sequence variant, missense variant
rs387907026 G>A Pathogenic Coding sequence variant, stop gained
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT017214 hsa-miR-335-5p Microarray 18185580
MIRT1321420 hsa-miR-1205 CLIP-seq
MIRT1321421 hsa-miR-1909 CLIP-seq
MIRT1321422 hsa-miR-3123 CLIP-seq
MIRT1321423 hsa-miR-320a CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005102 Function Signaling receptor binding IBA
GO:0005515 Function Protein binding IPI 32296183
GO:0005576 Component Extracellular region IEA
GO:0005576 Component Extracellular region NAS 24431302
GO:0005576 Component Extracellular region TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
610573 16175 ENSG00000101282
Protein
UniProt ID Q2I0M5
Protein name R-spondin-4 (Roof plate-specific spondin-4) (hRspo4)
Protein function Activator of the canonical Wnt signaling pathway by acting as a ligand for LGR4-6 receptors (PubMed:29769720). Upon binding to LGR4-6 (LGR4, LGR5 or LGR6), LGR4-6 associate with phosphorylated LRP6 and frizzled receptors that are activated by ex
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15913 Furin-like_2 35 135 Furin-like repeat, cysteine-rich Domain
Sequence
MRAPLCLLLLVAHAVDMLALNRRKKQVGTGLGGNCTGCIICSEENGCSTCQQRLFLFIRR
EGIRQYGKCLHDCPPGYFGIRGQEVNRCKKCGATCESCFSQDFCIRCKRQFYLYKGKCLP
TCPPGTLAHQNTREC
QGECELGPWGGWSPCTHNGKTCGSAWGLESRVREAGRAGHEEAAT
CQVLSESRKCPIQRPCPGERSPGQKKGRKDRRPRKDRKLDRRLDVRPRQPGLQP
Sequence length 234
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Wnt signaling pathway   Regulation of FZD by ubiquitination
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Anonychia anonychia rs775644973, rs74315420, rs74315421, rs74315422, rs74315423, rs387907026, rs387907027, rs387907028 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Astrocytoma Pilocytic astrocytoma N/A N/A GWAS
Cleft Lip With Or Without Cleft Palate Cleft lip with or without cleft palate N/A N/A GWAS
Nonsyndromic congenital nail disorder nonsyndromic congenital nail disorder 4 N/A N/A GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Anonychia congenita Associate 17186469, 17805348, 17914448, 23234511, 34099859, 36421794
Ectodermal Dysplasia Associate 36421794
Ependymoma Associate 32607579
Esophageal Neoplasms Associate 19472401
Nail Diseases Associate 17186469
Neoplasms Associate 17186469, 36611933
Thyroid Cancer Papillary Stimulate 36611933
Toenail Dystrophy Isolated Associate 23234511