NANOS3 (nanos C2HC-type zinc finger 3)

Gene

• Entrez ID: 342977
• Gene name: Nanos C2HC-type zinc finger 3
• Gene symbol: NANOS3
• Synonyms (NCBI Gene): NANOS1L, NOS3, ZC2HC12C
• Chromosome: 19
• Chromosome location: 19p13.12

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT2050255	hsa-miR-1182	CLIP-seq
MIRT2050256	hsa-miR-1915	CLIP-seq
MIRT2050257	hsa-miR-4437	CLIP-seq
MIRT2050258	hsa-miR-4505	CLIP-seq
MIRT2050259	hsa-miR-4685-5p	CLIP-seq
MIRT2050260	hsa-miR-4723-5p	CLIP-seq
MIRT2050261	hsa-miR-4726-3p	CLIP-seq
MIRT2050262	hsa-miR-4728-5p	CLIP-seq
MIRT2050263	hsa-miR-4731-5p	CLIP-seq
MIRT2050264	hsa-miR-637	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000932	Component	P-body	IEA
GO:0000932	Component	P-body	ISS
GO:0003723	Function	RNA binding	IEA
GO:0003723	Function	RNA binding	ISS
GO:0003729	Function	MRNA binding	IBA
GO:0005515	Function	Protein binding	IPI	24736845, 32296183
GO:0005634	Component	Nucleus	IDA	21421998
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	21421998
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0006417	Process	Regulation of translation	IEA
GO:0006417	Process	Regulation of translation	ISS
GO:0007281	Process	Germ cell development	IMP	21421998
GO:0007283	Process	Spermatogenesis	IEA
GO:0007283	Process	Spermatogenesis	ISS
GO:0008047	Function	Enzyme activator activity	IDA	24736845
GO:0008047	Function	Enzyme activator activity	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0010494	Component	Cytoplasmic stress granule	IEA
GO:0010494	Component	Cytoplasmic stress granule	ISS
GO:0017148	Process	Negative regulation of translation	IBA
GO:0017148	Process	Negative regulation of translation	IDA	24736845
GO:0017148	Process	Negative regulation of translation	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IBA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	22899867
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0048477	Process	Oogenesis	IBA
GO:0048477	Process	Oogenesis	IEA
GO:0048477	Process	Oogenesis	IEA
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0051726	Process	Regulation of cell cycle	ISS
GO:0061157	Process	MRNA destabilization	IDA	24736845
GO:0061157	Process	MRNA destabilization	IEA
GO:0097190	Process	Apoptotic signaling pathway	IEA
GO:2001234	Process	Negative regulation of apoptotic signaling pathway	IEA

Other IDs

• MIM: 608229
• HGNC: 22048
• e!Ensembl: ENSG00000187556

Protein

• UniProt ID: P60323
• Protein name: Nanos homolog 3 (NOS-3)
• Protein function: Plays a role in the maintenance of the undifferentiated state of germ cells regulating the spermatogonia cell cycle and inducing a prolonged transit in G1 phase. Affects cell proliferation probably by repressing translation of specific mRNAs. Ma
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF05741	zf-nanos	58 → 111	Nanos RNA binding domain	Family

• Tissue specificity: TISSUE SPECIFICITY: Ovary, testis and brain (at protein level). In the ovaries, expressed during multiple stages of oogenesis, including primordial, primary, secondary and antral follicles with the highest expression in the oocytes. In the testis, express
• Sequence:

  MGTFDLWTDYLGLAHLVRALSGKEGPETRLSPQPEPEPMLEPDQKRSLESSPAPERLCSF
  CKHNGESRAIYQSHVLKDEAGRVLCPILRDYVCPQCGATRERAHTRRFCPLTGQGYTSVY
  SHTTRNSAGKKLVRPDKAKTQDTGHRRGGGGGAGFRGAGKSEPSPSCSPSMST

• Sequence length: 173