Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	342977
Gene name Gene Name - the full gene name approved by the HGNC.	Nanos C2HC-type zinc finger 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	NANOS3
Synonyms (NCBI Gene) Gene synonyms aliases	NANOS1L, NOS3, ZC2HC12C
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19p13.12

Show/Hide all(10)

miRTarBase ID	miRNA	Experiments
MIRT2050255	hsa-miR-1182	CLIP-seq
MIRT2050256	hsa-miR-1915	CLIP-seq
MIRT2050257	hsa-miR-4437	CLIP-seq
MIRT2050258	hsa-miR-4505	CLIP-seq
MIRT2050259	hsa-miR-4685-5p	CLIP-seq
MIRT2050260	hsa-miR-4723-5p	CLIP-seq
MIRT2050261	hsa-miR-4726-3p	CLIP-seq
MIRT2050262	hsa-miR-4728-5p	CLIP-seq
MIRT2050263	hsa-miR-4731-5p	CLIP-seq
MIRT2050264	hsa-miR-637	CLIP-seq

Show/Hide all(20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000932	Component	P-body	ISS
GO:0003723	Function	RNA binding	ISS
GO:0003729	Function	MRNA binding	IBA	21873635
GO:0005515	Function	Protein binding	IPI	24736845
GO:0005634	Component	Nucleus	IDA	21421998
GO:0005737	Component	Cytoplasm	IDA	21421998
GO:0006417	Process	Regulation of translation	ISS
GO:0007275	Process	Multicellular organism development	IEA
GO:0007281	Process	Germ cell development	IMP	21421998
GO:0007283	Process	Spermatogenesis	ISS
GO:0008270	Function	Zinc ion binding	IEA
GO:0010494	Component	Cytoplasmic stress granule	ISS
GO:0017148	Process	Negative regulation of translation	IBA	21873635
GO:0017148	Process	Negative regulation of translation	IDA	24736845
GO:0048471	Component	Perinuclear region of cytoplasm	IBA	21873635
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	22899867
GO:0048477	Process	Oogenesis	IBA	21873635
GO:0051726	Process	Regulation of cell cycle	ISS
GO:1900153	Process	Positive regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay	IDA	24736845
GO:2001234	Process	Negative regulation of apoptotic signaling pathway	IEA

MIM	HGNC	e!Ensembl
608229	22048	ENSG00000187556

Protein

UniProt ID

P60323

Protein name

Nanos homolog 3 (NOS-3)

Protein function

Plays a role in the maintenance of the undifferentiated state of germ cells regulating the spermatogonia cell cycle and inducing a prolonged transit in G1 phase. Affects cell proliferation probably by repressing translation of specific mRNAs. Ma

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05741	zf-nanos	58 → 111	Nanos RNA binding domain	Family

Tissue specificity

TISSUE SPECIFICITY: Ovary, testis and brain (at protein level). In the ovaries, expressed during multiple stages of oogenesis, including primordial, primary, secondary and antral follicles with the highest expression in the oocytes. In the testis, express

Sequence

MGTFDLWTDYLGLAHLVRALSGKEGPETRLSPQPEPEPMLEPDQKRSLESSPAPERLCSF
CKHNGESRAIYQSHVLKDEAGRVLCPILRDYVCPQCGATRERAHTRRFCPLTGQGYTSVY
SHTTRNSAGKKLVRPDKAKTQDTGHRRGGGGGAGFRGAGKSEPSPSCSPSMST

Sequence length

173

Interactions

View interactions

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Breast Cancer	Breast Cancer	Importantly, breast cancer patients bearing PRC2 LOF mutations displayed significantly worse prognosis compared with PRC2 wild-type patients		GWAS, CBGDA

Show/Hide Text Mining Associations (3)

Disease Name	Relationship Type	References
Associations from Text Mining
Neoplasm Metastasis	Associate	36012673
Neoplasms	Stimulate	36012673
Primary Ovarian Insufficiency	Associate	17418157

NANOS3 (nanos C2HC-type zinc finger 3)