LEUTX (leucine twenty homeobox)

Gene Gene information from NCBI Gene database.
Gene Gene ontology Other IDs Protein
Entrez ID 342900
Gene name Leucine twenty homeobox
Gene symbol LEUTX
Synonyms (NCBI Gene)
-
Chromosome 19
Chromosome location 19q13.2
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
12
Gene Gene ontology Other IDs Protein
Show/Hide all (12)
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IEA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
618701 31953 ENSG00000213921
Protein Protein information from UniProt database.
Gene Gene ontology Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A8MZ59
Protein name Paired-like homeodomain transcription factor LEUTX (Leucine-twenty homeobox) (Paired-like homeobox transcription factor LEUTX) (PRD-LIKE homeobox transcription factor LEUTX)
Protein function [Isoform 1]: Paired-like homeobox transcription factor involved in embryogenesis (PubMed:27578796, PubMed:30479355). May act as a regulator of embryo genome activation (PubMed:27578796). Binds to a 36 bp DNA elements containing a 5'-TAATCC-3' se
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00046 Homeodomain 1 → 35 Homeodomain Domain
Sequence 
MFEGPRRYRRPRTRFLSKQLTALRELLEKTMHPSLATMGKLASKLQLDLSVVKIWFKNQR
AKWKRQQRQQMQTRPSLGPANQTTSVKKEETPSAITTANIRPVSPGISDANDHDLREPSG
IKNPGGASASARVSSWDSQSYDIEQICLGASNPPWASTLFEIDEFVKIYDLPGEDDTSSL
NQYLFPVCLEYDQLQSSV
Sequence length 198
Interactions View interactions