Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3429
Gene name Gene Name - the full gene name approved by the HGNC.	Interferon alpha inducible protein 27
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	IFI27
Synonyms (NCBI Gene) Gene synonyms aliases	FAM14D, ISG12, ISG12A, P27
Chromosome Chromosome number	14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	14q32.12

Show/Hide all(21)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021256	hsa-miR-146a-5p	Microarray	18057241
MIRT054031	hsa-miR-942-5p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	24970806
MIRT054031	hsa-miR-942-5p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	24970806
MIRT054031	hsa-miR-942-5p	Flow, Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	24727952
MIRT054031	hsa-miR-942-5p	Flow, Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	24727952
MIRT054031	hsa-miR-942-5p	Flow, Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	24727952
MIRT054031	hsa-miR-942-5p	Flow, Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	24727952
MIRT731055	hsa-miR-502-5p	qRT-PCR, Luciferase reporter assay, Immunohistochemistry, Western blot	25103640
MIRT731055	hsa-miR-502-5p	qRT-PCR, Luciferase reporter assay, Immunohistochemistry, Western blot	25103640
MIRT054031	hsa-miR-942-5p	Luciferase reporter assay, Western blotting, qRT-PCR	35974384
MIRT1556546	hsa-miR-2392	CLIP-seq
MIRT1556547	hsa-miR-3122	CLIP-seq
MIRT1556548	hsa-miR-3913-5p	CLIP-seq
MIRT1556549	hsa-miR-4259	CLIP-seq
MIRT1556550	hsa-miR-4268	CLIP-seq
MIRT1556551	hsa-miR-450b-3p	CLIP-seq
MIRT1556552	hsa-miR-4715-5p	CLIP-seq
MIRT1556553	hsa-miR-4726-3p	CLIP-seq
MIRT1556554	hsa-miR-720	CLIP-seq
MIRT1556555	hsa-miR-769-3p	CLIP-seq
MIRT1556546	hsa-miR-2392	CLIP-seq

Show/Hide all(38)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IGI	22427340
GO:0002376	Process	Immune system process	IEA
GO:0005515	Function	Protein binding	IPI	22427340, 27194766, 27673746, 32296183
GO:0005521	Function	Lamin binding	IDA	22427340
GO:0005634	Component	Nucleus	IEA
GO:0005635	Component	Nuclear envelope	IDA	11722583
GO:0005637	Component	Nuclear inner membrane	IDA	22427340
GO:0005637	Component	Nuclear inner membrane	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA	36426955
GO:0005739	Component	Mitochondrion	IEA
GO:0005741	Component	Mitochondrial outer membrane	TAS
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0006915	Process	Apoptotic process	IDA	18330707
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	IMP	27673746
GO:0016020	Component	Membrane	IEA
GO:0031966	Component	Mitochondrial membrane	IBA
GO:0031966	Component	Mitochondrial membrane	IDA	18330707, 27673746
GO:0031966	Component	Mitochondrial membrane	IEA
GO:0042802	Function	Identical protein binding	IDA	27673746
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IMP	27194766
GO:0044827	Process	Host-mediated perturbation of viral genome replication	IMP	27777077
GO:0045087	Process	Innate immune response	IEA
GO:0045087	Process	Innate immune response	IMP	27194766
GO:0046825	Process	Regulation of protein export from nucleus	IGI	22427340
GO:0051607	Process	Defense response to virus	IEA
GO:0051607	Process	Defense response to virus	IMP	27194766, 27777077
GO:0060090	Function	Molecular adaptor activity	IBA
GO:0060090	Function	Molecular adaptor activity	IDA	27194766
GO:0060337	Process	Type I interferon-mediated signaling pathway	IMP	27777077
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	22427340
GO:0070269	Process	Pyroptotic inflammatory response	IDA	35594856, 36426955
GO:0070269	Process	Pyroptotic inflammatory response	IDA	36426955
GO:0070936	Process	Protein K48-linked ubiquitination	IMP	27194766
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IMP	24970806
GO:0097193	Process	Intrinsic apoptotic signaling pathway	IBA

MIM	HGNC	e!Ensembl
600009	5397	ENSG00000165949

Protein

UniProt ID

P40305

Protein name

Interferon alpha-inducible protein 27, mitochondrial (p27) (Interferon alpha-induced 11.5 kDa protein) (Interferon-stimulated gene 12a protein) (ISG12(a)) (ISG12A)

Protein function

Probable adapter protein involved in different biological processes (PubMed:22427340, PubMed:27194766). Part of the signaling pathways that lead to apoptosis (PubMed:18330707, PubMed:24970806, PubMed:27673746). Involved in type-I interferon-indu

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF06140	Ifi-6-16	38 → 116	Interferon-induced 6-16 family	Family

Sequence

MEASALTSSAVTSVAKVVRVASGSAVVLPLARIATVVIGGVVAMAAVPMVLSAMGFTAAG
IASSSIAAKMMSAAAIANGGGVASGSLVATLQSLGATGLSGLTKFILGSIGSAIAAVIAR
FY

Sequence length

122

Interactions

View interactions

	Reactome
			Interferon alpha/beta signaling

IFI27 (interferon alpha inducible protein 27)