Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3428
Gene name Gene Name - the full gene name approved by the HGNC.
Interferon gamma inducible protein 16
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
IFI16
Synonyms (NCBI Gene) Gene synonyms aliases
IFNGIP1, PYHIN2
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q23.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the HIN-200 (hematopoietic interferon-inducible nuclear antigens with 200 amino acid repeats) family of cytokines. The encoded protein contains domains involved in DNA binding, transcriptional regulation, and protein-protein
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT017847 hsa-miR-335-5p Microarray 18185580
MIRT022657 hsa-miR-124-3p Proteomics;Microarray 18668037
MIRT027519 hsa-miR-98-5p Microarray 19088304
MIRT029441 hsa-miR-26b-5p Microarray 19088304
Transcription factors
Transcription factor Regulation Reference
AR Unknown 16494870
TP53 Activation 18974396
TP53 Unknown 11146555
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 12894224
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IMP 22046441
GO:0001819 Process Positive regulation of cytokine production TAS 22046441
GO:0002218 Process Activation of innate immune response IBA
GO:0002218 Process Activation of innate immune response IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
147586 5395 ENSG00000163565
Protein
UniProt ID Q16666
Protein name Gamma-interferon-inducible protein 16 (Ifi-16) (Interferon-inducible myeloid differentiation transcriptional activator)
Protein function Binds double-stranded DNA. Binds preferentially to supercoiled DNA and cruciform DNA structures. Seems to be involved in transcriptional regulation. May function as a transcriptional repressor. Could have a role in the regulation of hematopoieti
PDB 2OQ0 , 3B6Y , 3RLN , 3RLO , 3RNU , 4QGU , 8X70
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02758 PYRIN 8 80 PAAD/DAPIN/Pyrin domain Domain
PF02760 HIN 201 369 HIN-200/IF120x domain Family
PF02760 HIN 574 740 HIN-200/IF120x domain Family
Tissue specificity TISSUE SPECIFICITY: Expressed in peripheral blood leukocytes, fibroblasts and lymphoid cells. Present in myeloid precursors (CD34+) and throughout monocyte development, but its expression is down-regulated in erythroid and polymorphonuclear precursor cell
Sequence
MGKKYKNIVLLKGLEVINDYHFRMVKSLLSNDLKLNLKMREEYDKIQIADLMEEKFRGDA
GLGKLIKIFEDIPTLEDLAE
TLKKEKLKVKGPALSRKRKKEVDATSPAPSTSSTVKTEGA
EATPGAQKRKKSTKEKAGPKGSKVSEEQTQPPSPAGAGMSTAMGRSPSPKTSLSAPPNSS
STENPKTVAKCQVTPRRNVLQKRPVIVKVLSTTKPFEYETPEMEKKIMFHATVATQTQFF
HVKVLNTSLKEKFNGKKIIIISDYLEYDSLLEVNEESTVSEAGPNQTFEVPNKIINRAKE
TLKIDILHKQASGNIVYGVFMLHKKTVNQKTTIYEIQDDRGKMDVVGTGQCHNIPCEEGD
KLQLFCFRL
RKKNQMSKLISEMHSFIQIKKKTNPRNNDPKSMKLPQEQRQLPYPSEASTT
FPESHLRTPQMPPTTPSSSFFTKKSEDTISKMNDFMRMQILKEGSHFPGPFMTSIGPAES
HPHTPQMPPSTPSSSFLTTKSEDTISKMNDFMRMQILKEGSHFPGPFMTSIGPAESHPHT
PQMPPSTPSSSFLTTLKPRLKTEPEEVSIEDSAQSDLKEVMVLNATESFVYEPKEQKKMF
HATVATENEVFRVKVFNIDLKEKFTPKKIIAIANYVCRNGFLEVYPFTLVADVNADRNME
IPKGLIRSASVTPKINQLCSQTKGSFVNGVFEVHKKNVRGEFTYYEIQDNTGKMEVVVHG
RLTTINCEEGDKLKLTCFEL
APKSGNTGELRSVIHSHIKVIKTRKNKKDILNPDSSMETS
PDFFF
Sequence length 785
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  NOD-like receptor signaling pathway
Cytosolic DNA-sensing pathway
  STING mediated induction of host immune responses
IRF3-mediated induction of type I IFN
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Ovarian cancer Epithelial ovarian cancer N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Acute On Chronic Liver Failure Associate 29743020
Adenocarcinoma of Lung Associate 35273829
Arthritis Rheumatoid Associate 16108817, 26316393
Ataxia Telangiectasia Associate 21471287
Autistic Disorder Associate 18378158
Autoimmune Diseases Associate 26271464, 26316393, 31665637
Brain Diseases Associate 18378158
Breast Neoplasms Inhibit 14990579
Breast Neoplasms Associate 25375629
Carcinogenesis Inhibit 34216619