Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID	3428
Gene name	Interferon gamma inducible protein 16
Gene symbol	IFI16
Synonyms (NCBI Gene)	IFNGIP1PYHIN2
Chromosome	1
Chromosome location	1q23.1
Summary	This gene encodes a member of the HIN-200 (hematopoietic interferon-inducible nuclear antigens with 200 amino acid repeats) family of cytokines. The encoded protein contains domains involved in DNA binding, transcriptional regulation, and protein-protein

Show/Hide all (4)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017847	hsa-miR-335-5p	Microarray	18185580
MIRT022657	hsa-miR-124-3p	Proteomics;Microarray	18668037
MIRT027519	hsa-miR-98-5p	Microarray	19088304
MIRT029441	hsa-miR-26b-5p	Microarray	19088304

Show/Hide all (3)

Transcription factor	Regulation	Reference
AR	Unknown	16494870
TP53	Activation	18974396
TP53	Unknown	11146555

Show/Hide all (52)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	12894224
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	22046441
GO:0001819	Process	Positive regulation of cytokine production	TAS	22046441
GO:0002218	Process	Activation of innate immune response	IBA
GO:0002218	Process	Activation of innate immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003690	Function	Double-stranded DNA binding	IBA
GO:0003690	Function	Double-stranded DNA binding	IDA	7536752, 30104205
GO:0003723	Function	RNA binding	HDA	22658674
GO:0005515	Function	Protein binding	IPI	11146555, 14654789, 16494870, 20890285, 21397192, 24413532, 24531343, 30104205, 30833792
GO:0005634	Component	Nucleus	IDA	7536752, 19158679, 24413532, 24531343
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IBA
GO:0005654	Component	Nucleoplasm	IDA	14654789
GO:0005730	Component	Nucleolus	IBA
GO:0005730	Component	Nucleolus	IDA	14654789
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IDA	30104205
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IPI	24531343
GO:0005829	Component	Cytosol	TAS
GO:0006914	Process	Autophagy	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0008134	Function	Transcription factor binding	IDA	12894224, 22291595
GO:0010506	Process	Regulation of autophagy	IEP	21573174
GO:0016020	Component	Membrane	HDA	19946888
GO:0016607	Component	Nuclear speck	IDA	19158679
GO:0030099	Process	Myeloid cell differentiation	NAS	7536752
GO:0030224	Process	Monocyte differentiation	IDA	9766636
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IDA	21575908
GO:0035458	Process	Cellular response to interferon-beta	IBA
GO:0035458	Process	Cellular response to interferon-beta	IEA
GO:0042149	Process	Cellular response to glucose starvation	IDA	21573174
GO:0042771	Process	Intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	IDA	14654789
GO:0042802	Function	Identical protein binding	IPI	9718316, 24237704
GO:0043392	Process	Negative regulation of DNA binding	IDA	22291595
GO:0045071	Process	Negative regulation of viral genome replication	IDA	22291595
GO:0045087	Process	Innate immune response	IEA
GO:0045814	Process	Negative regulation of gene expression, epigenetic	IMP	24413532
GO:0045824	Process	Negative regulation of innate immune response	IDA	22046441, 30104205
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	9642285
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	11146555
GO:0050727	Process	Regulation of inflammatory response	IDA	21575908
GO:0051607	Process	Defense response to virus	IDA	21478870
GO:0051607	Process	Defense response to virus	IMP	21575908
GO:0071479	Process	Cellular response to ionizing radiation	IDA	14654789
GO:0072332	Process	Intrinsic apoptotic signaling pathway by p53 class mediator	IMP	21573174
GO:0140972	Process	Negative regulation of AIM2 inflammasome complex assembly	IDA	30104205

MIM	HGNC	e!Ensembl
147586	5395	ENSG00000163565

Q16666

Protein name

Gamma-interferon-inducible protein 16 (Ifi-16) (Interferon-inducible myeloid differentiation transcriptional activator)

Protein function

Binds double-stranded DNA. Binds preferentially to supercoiled DNA and cruciform DNA structures. Seems to be involved in transcriptional regulation. May function as a transcriptional repressor. Could have a role in the regulation of hematopoieti

PDB

2OQ0 , 3B6Y , 3RLN , 3RLO , 3RNU , 4QGU , 8X70

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02758	PYRIN	8 → 80	PAAD/DAPIN/Pyrin domain	Domain
PF02760	HIN	201 → 369	HIN-200/IF120x domain	Family
PF02760	HIN	574 → 740	HIN-200/IF120x domain	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in peripheral blood leukocytes, fibroblasts and lymphoid cells. Present in myeloid precursors (CD34+) and throughout monocyte development, but its expression is down-regulated in erythroid and polymorphonuclear precursor cell

Sequence

MGKKYKNIVLLKGLEVINDYHFRMVKSLLSNDLKLNLKMREEYDKIQIADLMEEKFRGDA
GLGKLIKIFEDIPTLEDLAETLKKEKLKVKGPALSRKRKKEVDATSPAPSTSSTVKTEGA
EATPGAQKRKKSTKEKAGPKGSKVSEEQTQPPSPAGAGMSTAMGRSPSPKTSLSAPPNSS
STENPKTVAKCQVTPRRNVLQKRPVIVKVLSTTKPFEYETPEMEKKIMFHATVATQTQFF
HVKVLNTSLKEKFNGKKIIIISDYLEYDSLLEVNEESTVSEAGPNQTFEVPNKIINRAKE
TLKIDILHKQASGNIVYGVFMLHKKTVNQKTTIYEIQDDRGKMDVVGTGQCHNIPCEEGD
KLQLFCFRLRKKNQMSKLISEMHSFIQIKKKTNPRNNDPKSMKLPQEQRQLPYPSEASTT
FPESHLRTPQMPPTTPSSSFFTKKSEDTISKMNDFMRMQILKEGSHFPGPFMTSIGPAES
HPHTPQMPPSTPSSSFLTTKSEDTISKMNDFMRMQILKEGSHFPGPFMTSIGPAESHPHT
PQMPPSTPSSSFLTTLKPRLKTEPEEVSIEDSAQSDLKEVMVLNATESFVYEPKEQKKMF
HATVATENEVFRVKVFNIDLKEKFTPKKIIAIANYVCRNGFLEVYPFTLVADVNADRNME
IPKGLIRSASVTPKINQLCSQTKGSFVNGVFEVHKKNVRGEFTYYEIQDNTGKMEVVVHG
RLTTINCEEGDKLKLTCFELAPKSGNTGELRSVIHSHIKVIKTRKNKKDILNPDSSMETS
PDFFF

Sequence length

785

Interactions

View interactions

	KEGG		Reactome
	NOD-like receptor signaling pathway Cytosolic DNA-sensing pathway		STING mediated induction of host immune responses IRF3-mediated induction of type I IFN

IFI16 (interferon gamma inducible protein 16)