IFI16 (interferon gamma inducible protein 16)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3428
Gene name Gene Name - the full gene name approved by the HGNC.
Interferon gamma inducible protein 16
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
IFI16
Synonyms (NCBI Gene) Gene synonyms aliases
IFNGIP1, PYHIN2
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q23.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the HIN-200 (hematopoietic interferon-inducible nuclear antigens with 200 amino acid repeats) family of cytokines. The encoded protein contains domains involved in DNA binding, transcriptional regulation, and protein-protein
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(4)
miRTarBase ID miRNA Experiments Reference
MIRT017847 hsa-miR-335-5p Microarray 18185580
MIRT022657 hsa-miR-124-3p Proteomics;Microarray 18668037
MIRT027519 hsa-miR-98-5p Microarray 19088304
MIRT029441 hsa-miR-26b-5p Microarray 19088304
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(3)
Transcription factor Regulation Reference
AR Unknown 16494870
TP53 Activation 18974396
TP53 Unknown 11146555
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(46)
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 12894224, 24413532
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IMP 22046441
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 24413532
GO:0001227 Function DNA-binding transcription repressor activity, RNA polymerase II-specific IDA 24413532
GO:0001819 Process Positive regulation of cytokine production TAS 22046441
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
147586 5395 ENSG00000163565
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q16666
Protein name Gamma-interferon-inducible protein 16 (Ifi-16) (Interferon-inducible myeloid differentiation transcriptional activator)
Protein function Binds double-stranded DNA. Binds preferentially to supercoiled DNA and cruciform DNA structures. Seems to be involved in transcriptional regulation. May function as a transcriptional repressor. Could have a role in the regulation of hematopoieti
PDB 2OQ0 , 3B6Y , 3RLN , 3RLO , 3RNU , 4QGU , 8X70
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02758 PYRIN 8 → 80 PAAD/DAPIN/Pyrin domain Domain
PF02760 HIN 201 → 369 HIN-200/IF120x domain Family
PF02760 HIN 574 → 740 HIN-200/IF120x domain Family
Tissue specificity TISSUE SPECIFICITY: Expressed in peripheral blood leukocytes, fibroblasts and lymphoid cells. Present in myeloid precursors (CD34+) and throughout monocyte development, but its expression is down-regulated in erythroid and polymorphonuclear precursor cell
Sequence 
MGKKYKNIVLLKGLEVINDYHFRMVKSLLSNDLKLNLKMREEYDKIQIADLMEEKFRGDA
GLGKLIKIFEDIPTLEDLAETLKKEKLKVKGPALSRKRKKEVDATSPAPSTSSTVKTEGA
EATPGAQKRKKSTKEKAGPKGSKVSEEQTQPPSPAGAGMSTAMGRSPSPKTSLSAPPNSS
STENPKTVAKCQVTPRRNVLQKRPVIVKVLSTTKPFEYETPEMEKKIMFHATVATQTQFF
HVKVLNTSLKEKFNGKKIIIISDYLEYDSLLEVNEESTVSEAGPNQTFEVPNKIINRAKE
TLKIDILHKQASGNIVYGVFMLHKKTVNQKTTIYEIQDDRGKMDVVGTGQCHNIPCEEGD
KLQLFCFRLRKKNQMSKLISEMHSFIQIKKKTNPRNNDPKSMKLPQEQRQLPYPSEASTT
FPESHLRTPQMPPTTPSSSFFTKKSEDTISKMNDFMRMQILKEGSHFPGPFMTSIGPAES
HPHTPQMPPSTPSSSFLTTKSEDTISKMNDFMRMQILKEGSHFPGPFMTSIGPAESHPHT
PQMPPSTPSSSFLTTLKPRLKTEPEEVSIEDSAQSDLKEVMVLNATESFVYEPKEQKKMF
HATVATENEVFRVKVFNIDLKEKFTPKKIIAIANYVCRNGFLEVYPFTLVADVNADRNME
IPKGLIRSASVTPKINQLCSQTKGSFVNGVFEVHKKNVRGEFTYYEIQDNTGKMEVVVHG
RLTTINCEEGDKLKLTCFELAPKSGNTGELRSVIHSHIKVIKTRKNKKDILNPDSSMETS
PDFFF
Sequence length 785
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  NOD-like receptor signaling pathway
Cytosolic DNA-sensing pathway 		  STING mediated induction of host immune responses
IRF3-mediated induction of type I IFN
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Autoimmune diseases Autoimmune Diseases rs869025224 21383967
Show/Hide Unknown Diseases (1)
Unknown
Disease term Disease name Evidence References Source
Ovarian cancer Ovarian cancer Conditional KD of IL6 in the OCCA xenograft model delays tumor growth GWAS, CBGDA
Show/Hide Text Mining Associations (84)
Associations from Text Mining
Disease Name Relationship Type References
Acute On Chronic Liver Failure Associate 29743020
Adenocarcinoma of Lung Associate 35273829
Arthritis Rheumatoid Associate 16108817, 26316393
Ataxia Telangiectasia Associate 21471287
Autistic Disorder Associate 18378158
Autoimmune Diseases Associate 26271464, 26316393, 31665637
Brain Diseases Associate 18378158
Breast Neoplasms Inhibit 14990579
Breast Neoplasms Associate 25375629
Carcinogenesis Inhibit 34216619