Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
342667
Gene name Gene Name - the full gene name approved by the HGNC.
SH3 and cysteine rich domain 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
STAC2
Synonyms (NCBI Gene) Gene synonyms aliases
24b2, 24b2/STAC2
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q12
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein containing an SH3 domain and a zinc finger domain. The encoded protein has been shown to regulate calcium channel inactivation in a human cell line. Reduced expression of this gene has been observed in human heart failure. [pro
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs863223351 C>T Likely-pathogenic Missense variant, intron variant, non coding transcript variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT706374 hsa-miR-106a-5p HITS-CLIP 22927820
MIRT706373 hsa-miR-106b-5p HITS-CLIP 22927820
MIRT706372 hsa-miR-17-5p HITS-CLIP 22927820
MIRT706371 hsa-miR-20a-5p HITS-CLIP 22927820
MIRT706370 hsa-miR-20b-5p HITS-CLIP 22927820
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003009 Process Skeletal muscle contraction IBA
GO:0005515 Function Protein binding IPI 16713569, 25416956, 32296183, 32814053
GO:0005737 Component Cytoplasm IEA
GO:0005829 Component Cytosol IEA
GO:0005886 Component Plasma membrane IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein
UniProt ID Q6ZMT1
Protein name SH3 and cysteine-rich domain-containing protein 2 (24b2/STAC2) (Src homology 3 and cysteine-rich domain-containing protein 2)
Protein function Plays a redundant role in promoting the expression of calcium channel CACNA1S at the cell membrane, and thereby contributes to increased channel activity. Slows down the inactivation rate of the calcium channel CACNA1C. {ECO:0000250|UniProtKB:Q8
PDB 6B26 , 6B27 , 6B28
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00130 C1_1 111 164 Phorbol esters/diacylglycerol binding domain (C1 domain) Domain
PF16664 STAC2_u1 167 295 Disordered
PF14604 SH3_9 299 347 Variant SH3 domain Domain
Sequence
MTEMSEKENEPDDAATHSPPGTVSALQETKLQRFKRSLSLKTILRSKSLENFFLRSGSEL
KCPTEVLLTPPTPLPPPSPPPTASDRGLATPSPSPCPVPRPLAALKPVRLHSFQEHVFKR
ASPCELCHQLIVGNSKQGLRCKMCKVSVHLWCSEEISHQQCPGK
TSTSFRRNFSSPLLVH
EPPPVCATSKESPPTGDSGKVDPVYETLRYGTSLALMNRSSFSSTSESPTRSLSERDELT
EDGEGSIRSSEEGPGDSASPVFTAPAESEGPGPEEKSPGQQLPKATLRKDVGPMY
SYVAL
YKFLPQENNDLALQPGDRIMLVDDSNEDWWKGKIGDRVGFFPANFVQ
RVRPGENVWRCCQ
PFSGNKEQGYMSLKENQICVGVGRSKDADGFIRVSSGKKRGLVPVDALTEI
Sequence length 411
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Schizophrenia Childhood-onset schizophrenia rs863223351 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Asthma Asthma (childhood onset) N/A N/A GWAS
Moyamoya Disease Moyamoya disease N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 27506935, 31182966
Heart Failure Associate 25725476