Gene Gene information from NCBI Gene database.
Entrez ID 342510
Gene name CD300e molecule
Gene symbol CD300E
Synonyms (NCBI Gene)
CD300LECLM-2CLM2CMRF35-A5IREM-2IREM2PIgR-2PIgR2
Chromosome 17
Chromosome location 17q25.1
Summary This gene encodes a member of the CD300 glycoprotein family of cell surface proteins expressed on myeloid cells. The protein interacts with the TYRO protein tyrosine kinase-binding protein and is thought to act as an activating receptor. [provided by RefS
miRNA miRNA information provided by mirtarbase database.
1050
miRTarBase ID miRNA Experiments Reference
MIRT607299 hsa-miR-7110-3p HITS-CLIP 23706177
MIRT607298 hsa-miR-6817-3p HITS-CLIP 23706177
MIRT607292 hsa-miR-3120-5p HITS-CLIP 23706177
MIRT607290 hsa-miR-6895-3p HITS-CLIP 23706177
MIRT607289 hsa-miR-593-3p HITS-CLIP 23706177
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
9
GO ID Ontology Definition Evidence Reference
GO:0002376 Process Immune system process IEA
GO:0004888 Function Transmembrane signaling receptor activity IBA
GO:0005515 Function Protein binding IPI 20959446, 29051512, 32296183
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
609801 28874 ENSG00000186407
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q496F6
Protein name CMRF35-like molecule 2 (CLM-2) (CD300 antigen-like family member E) (CMRF35-A5) (Immune receptor expressed on myeloid cells 2) (IREM-2) (Polymeric immunoglobulin receptor 2) (PIgR-2) (PIgR2) (Poly-Ig receptor 2) (CD antigen CD300e)
Protein function Probably acts as an activating receptor.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07686 V-set 19 127 Immunoglobulin V-set domain Domain
Tissue specificity TISSUE SPECIFICITY: Present on the surface of mature hematopoietic cells of the monocyte and myeloid lineages (at protein level). {ECO:0000269|PubMed:15557162}.
Sequence
MWLLPALLLLCLSGCLSLKGPGSVTGTAGDSLTVWCQYESMYKGYNKYWCRGQYDTSCES
IVETKGEEKVERNGRVSIRDHPEALAFTVTMQNLNEDDAGSYWCKIQTVWVLDSWSRDPS
DLVRVYV
SPAITTPRRTTHPATPPIFLVVNPGRNLSTGEVLTQNSGFRLSSPHFLLVVLL
KLPLLLSMLGAVFWVNRPQWAPPGR
Sequence length 205
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
DAP12 interactions