ZNF774 (zinc finger protein 774)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 342132
Gene name Zinc finger protein 774
Gene symbol ZNF774
Synonyms (NCBI Gene)
-
Chromosome 15
Chromosome location 15q26.1
miRNA miRNA information provided by mirtarbase database.
81
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (81)
miRTarBase ID miRNA Experiments Reference
MIRT448262 hsa-miR-4500 PAR-CLIP 22100165
MIRT448263 hsa-let-7d-5p PAR-CLIP 22100165
MIRT448261 hsa-let-7b-5p PAR-CLIP 22100165
MIRT448260 hsa-let-7a-5p PAR-CLIP 22100165
MIRT448259 hsa-let-7e-5p PAR-CLIP 22100165
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
9
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (9)
GO ID Ontology Definition Evidence Reference
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0003677 Function DNA binding IEA
GO:0005515 Function Protein binding IPI 25416956, 31515488, 32296183, 32814053
GO:0005634 Component Nucleus IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6NX45
Protein name Zinc finger protein 774
Protein function May be involved in transcriptional regulation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 152 → 173 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 179 → 201 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 207 → 229 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 235 → 257 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 263 → 285 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 291 → 313 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 319 → 341 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 347 → 369 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 375 → 397 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 403 → 425 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 431 → 453 Zinc finger, C2H2 type Domain
Sequence 
MWLGTSGKSGLPGHCLENPLQECHPAQLEEWALKGISRPSVISQPEQKEEPWVLPLQNFE
ARKIPRESHTDCEHQVAKLNQDNSETAEQCGTSSERTNKDLSHTLSWGGNWEQGLELEGQ
HGTLPGEGQLESFSQERDLNKLLDGYVGEKPMCAECGKSFNQSSYLIRHLRTHTGERPYT
CIECGKGFKQSSDLVTHRRTHTGEKPYQCKGCEKKFSDSSTLIKHQRTHTGERPYECPEC
GKTFGRKPHLIMHQRTHTGEKPYACLECHKSFSRSSNFITHQRTHTGVKPYRCNDCGESF
SQSSDLIKHQRTHTGERPFKCPECGKGFRDSSHFVAHMSTHSGERPFSCPDCHKSFSQSS
HLVTHQRTHTGERPFKCENCGKGFADSSALIKHQRIHTGERPYKCGECGKSFNQSSHFIT
HQRIHLGDRPYRCPECGKTFNQRSHFLTHQRTHTGEKPFHCSKCNKSFRQKAHLLCHQNT
HLI
Sequence length 483
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Generic Transcription Pathway
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Show/Hide Unknown Diseases (1)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
RHEUMATOID ARTHRITIS — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations