Gene Gene information from NCBI Gene database.
Entrez ID 342035
Gene name Gliomedin
Gene symbol GLDN
Synonyms (NCBI Gene)
CLOMCOLMCRG-L2CRGL2LCCS11UNC-112UNC-122
Chromosome 15
Chromosome location 15q21.2
Summary This gene encodes a protein that contains olfactomedin-like and collagen-like domains. The encoded protein, which exists in both transmembrane and secreted forms, promotes formation of the nodes of Ranvier in the peripheral nervous system. Mutations in th
SNPs SNP information provided by dbSNP.
16
SNP ID Visualize variation Clinical significance Consequence
rs141816048 A>G Likely-pathogenic Intron variant, splice acceptor variant
rs147954907 G>A Likely-pathogenic, uncertain-significance Missense variant, coding sequence variant
rs186935606 C>T Conflicting-interpretations-of-pathogenicity Coding sequence variant, missense variant, genic upstream transcript variant, 5 prime UTR variant
rs199538582 G>A,C,T Likely-pathogenic Coding sequence variant, missense variant, intron variant
rs368085516 C>A,G,T Pathogenic Missense variant, intron variant, synonymous variant, coding sequence variant, stop gained
miRNA miRNA information provided by mirtarbase database.
391
miRTarBase ID miRNA Experiments Reference
MIRT025832 hsa-miR-7-5p Microarray 17612493
MIRT497645 hsa-miR-29a-3p PAR-CLIP 22291592
MIRT497644 hsa-miR-29b-3p PAR-CLIP 22291592
MIRT497643 hsa-miR-29c-3p PAR-CLIP 22291592
MIRT497642 hsa-miR-6871-3p PAR-CLIP 22291592
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
17
GO ID Ontology Definition Evidence Reference
GO:0005576 Component Extracellular region IEA
GO:0005581 Component Collagen trimer IEA
GO:0005615 Component Extracellular space IBA
GO:0005615 Component Extracellular space IEA
GO:0005886 Component Plasma membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
608603 29514 ENSG00000186417
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6ZMI3
Protein name Gliomedin [Cleaved into: Gliomedin shedded ectodomain]
Protein function Ligand for NRCAM and NFASC/neurofascin that plays a role in the formation and maintenance of the nodes of Ranvier on myelinated axons. Mediates interaction between Schwann cell microvilli and axons via its interactions with NRCAM and NFASC. Node
PDB 5YBY
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01391 Collagen 136 193 Collagen triple helix repeat (20 copies) Repeat
PF01391 Collagen 166 225 Collagen triple helix repeat (20 copies) Repeat
PF02191 OLF 304 544 Olfactomedin-like domain Family
Tissue specificity TISSUE SPECIFICITY: Specifically expressed in spinal cord, brain, placenta and sciatic nerve. More abundant in peripheral than central nervous system. {ECO:0000269|PubMed:16039564}.
Sequence
MARGAEGGRGDAGWGLRGALAAVALLSALNAAGTVFALCQWRGLSSALRALEAQRGREQR
EDSALRSFLAELSRAPRGASAPPQDPASSARNKRSHSGEPAPHIRAESHDMLMMMTYSMV
PIRVMVDLCNSTKGICLTGPSGPPGPPGAGGLPGHNGLDGQPGPQGPKGEKGANGKRGKM
GIPGAAGNPGERG
EKGDHGELGLQGNEGPPGQKGEKGDKGDVSND
VLLAGAKGDQGPPGP
PGPPGPPGPPGPPGSRRAKGPRQPSMFNGQCPGETCAIPNDDTLVGKADEKASEHHSPQA
ESMITSIGNPVQVLKVTETFGTWIRESANKSDDRIWVTEHFSGIMVKEFKDQPSLLNGSY
TFIHLPYYFHGCGHVVYNNSLYYHKGGSNTLVRFEFGQETSQTLKLENALYFDRKYLFAN
SKTYFNLAVDEKGLWIIYASSVDGSSILVAQLDERTFSVVQHVNTTYPKSKAGNAFIARG
ILYVTDTKDMRVTFAFDLLGGKQINANFDLRTSQSVLAMLAYNMRDQHLYSWEDGHLMLY
PVQF
LSTTLNQ
Sequence length 551
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
73
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Arthrogryposis multiplex congenita Likely pathogenic; Pathogenic rs750803388 RCV000855464
Breathing dysregulation Likely pathogenic; Pathogenic rs775011495 RCV000627011
Congenital contracture Likely pathogenic; Pathogenic rs775011495 RCV000627011
Fetal akinesia deformation sequence 1 Likely pathogenic; Pathogenic rs750803388, rs376573993 RCV000855464
RCV001842583
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Aromatase deficiency Conflicting classifications of pathogenicity rs779432560 RCV004731075
Lung cancer Benign rs139283412 RCV005924624
Thyroid cancer, nonmedullary, 1 Benign rs139283412 RCV005924623
Uterine corpus endometrial carcinoma Benign rs139283412 RCV005924625
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Alcoholism Associate 24890784
Arthrogryposis Associate 27616481, 33820833
Bone Diseases Developmental Associate 33820833
Breast Neoplasms Associate 24324964
Carcinoma Hepatocellular Associate 32644941
Colorectal Neoplasms Associate 32323816
Endometrial Neoplasms Associate 17827443, 22320986
Fetal akinesia syndrome X linked Associate 32779773
Genetic Diseases Inborn Associate 27616481
Hypertension Associate 32407592