Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	341032
Gene name Gene Name - the full gene name approved by the HGNC.	POU class 2 homeobox associating factor 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	POU2AF2
Synonyms (NCBI Gene) Gene synonyms aliases	C11orf53, OCA-T1, OCAT1
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11q23.1

Show/Hide all(15)

miRTarBase ID	miRNA	Experiments
MIRT829969	hsa-miR-1228	CLIP-seq
MIRT829970	hsa-miR-1587	CLIP-seq
MIRT829971	hsa-miR-1910	CLIP-seq
MIRT829972	hsa-miR-3140-5p	CLIP-seq
MIRT829973	hsa-miR-329	CLIP-seq
MIRT829974	hsa-miR-362-3p	CLIP-seq
MIRT829975	hsa-miR-4492	CLIP-seq
MIRT829976	hsa-miR-4498	CLIP-seq
MIRT829977	hsa-miR-4656	CLIP-seq
MIRT829978	hsa-miR-4675	CLIP-seq
MIRT829979	hsa-miR-4741	CLIP-seq
MIRT829980	hsa-miR-4790-3p	CLIP-seq
MIRT829981	hsa-miR-642b	CLIP-seq
MIRT829982	hsa-miR-762	CLIP-seq
MIRT2435836	hsa-miR-4778-5p	CLIP-seq

Show/Hide all(13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003677	Function	DNA binding	IEA
GO:0003713	Function	Transcription coactivator activity	IBA
GO:0003713	Function	Transcription coactivator activity	IDA	35576971
GO:0005515	Function	Protein binding	IPI	35576971
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	35576971
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IEA
GO:0043565	Function	Sequence-specific DNA binding	IBA
GO:0043565	Function	Sequence-specific DNA binding	IDA	35576971
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0070974	Function	POU domain binding	IEA

MIM	HGNC	e!Ensembl
620671	30527	ENSG00000150750

Protein

UniProt ID

Q8IXP5

Protein name

POU domain class 2-associating factor 2 (Oct coactivator from tuft cells 1) (Protein OCA-T1) (POU class 2 homeobox-associating factor 2)

Protein function

Transcriptional coactivator of POU2F3 (PubMed:35576971, PubMed:36197978). This complex drives the development of tuft cells, a rare chemosensory cells that coordinate immune and neural functions within mucosal epithelial tissues (PubMed:35576971

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF17721	DUF5566	3 → 236	Family of unknown function (DUF5566)	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in tuft cells of colon mucosa, as well as in small intestine and thymus (PubMed:35576971). {ECO:0000269|PubMed:25048349, ECO:0000269|PubMed:35576971}.

Sequence

MPGSPVTSGYYGVRRSFLSDSDFHNSKQFSNDVYTSSVGKPFPCESSAGQSHAALLEPYF
PQEPYGDYRPPALTPNAGSLFSASPLPPLLPPPFPGDPAHFLFRDSWEQTLPDGLSQPDP
VSADALLTLPPSTSCLSQLESGSIAQHRGSSWGSSLAGAQSYSLHALEDLHHTPGYPTPP
PYPFTPFMTVSNDLPPKVGPLSPDEEADTGSLHDPSPWVKEDGSIAWGSYECRRAY

Sequence length

236

Interactions

View interactions

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Colorectal Cancer	Colorectal cancer, ICD10 C18, C19, C20: colorectal cancer	N/A	N/A	GWAS

POU2AF2 (POU class 2 homeobox associating factor 2)