APOC1 (apolipoprotein C1)

Gene

• Entrez ID: 341
• Gene name: Apolipoprotein C1
• Gene symbol: APOC1
• Synonyms (NCBI Gene): APOC1B, Apo-CI, ApoC-I, apo-CIB, apoC-IB
• Chromosome: 19
• Chromosome location: 19q13.32
• Summary: This gene encodes a member of the apolipoprotein C1 family. This gene is expressed primarily in the liver, and it is activated when monocytes differentiate into macrophages. The encoded protein plays a central role in high density lipoprotein (HDL) and ve

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018338	hsa-miR-335-5p	Microarray	18185580
MIRT018338	hsa-miR-335-5p	Microarray	34081622

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004859	Function	Phospholipase inhibitor activity	IBA
GO:0004859	Function	Phospholipase inhibitor activity	IDA	2302419
GO:0005504	Function	Fatty acid binding	IBA
GO:0005504	Function	Fatty acid binding	IDA	17339654
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005783	Component	Endoplasmic reticulum	IDA
GO:0006629	Process	Lipid metabolic process	TAS	2897845
GO:0006641	Process	Triglyceride metabolic process	IBA
GO:0006641	Process	Triglyceride metabolic process	IEA
GO:0006869	Process	Lipid transport	IEA
GO:0008203	Process	Cholesterol metabolic process	IEA
GO:0010897	Process	Negative regulation of triglyceride catabolic process	IDA	15576844
GO:0010900	Process	Negative regulation of phosphatidylcholine catabolic process	IDA	2302419
GO:0010916	Process	Negative regulation of very-low-density lipoprotein particle clearance	IBA
GO:0010916	Process	Negative regulation of very-low-density lipoprotein particle clearance	IDA	1917954
GO:0031210	Function	Phosphatidylcholine binding	TAS	2302419
GO:0032374	Process	Regulation of cholesterol transport	IDA	15576844
GO:0032375	Process	Negative regulation of cholesterol transport	IBA
GO:0032375	Process	Negative regulation of cholesterol transport	IDA	10978346
GO:0033344	Process	Cholesterol efflux	IDA	11162594
GO:0033700	Process	Phospholipid efflux	IDA	11162594
GO:0034361	Component	Very-low-density lipoprotein particle	IBA
GO:0034361	Component	Very-low-density lipoprotein particle	IDA	15576844
GO:0034361	Component	Very-low-density lipoprotein particle	IEA
GO:0034364	Component	High-density lipoprotein particle	IBA
GO:0034364	Component	High-density lipoprotein particle	IDA	15576844
GO:0034369	Process	Plasma lipoprotein particle remodeling	IDA	10978346
GO:0034375	Process	High-density lipoprotein particle remodeling	TAS	18992221
GO:0034379	Process	Very-low-density lipoprotein particle assembly	TAS	18992221
GO:0034382	Process	Chylomicron remnant clearance	IDA	4020294
GO:0034447	Process	Very-low-density lipoprotein particle clearance	IBA
GO:0034447	Process	Very-low-density lipoprotein particle clearance	IDA	15576844
GO:0042157	Process	Lipoprotein metabolic process	IEA
GO:0042627	Component	Chylomicron	TAS	18992221
GO:0045717	Process	Negative regulation of fatty acid biosynthetic process	IDA	15576844
GO:0045833	Process	Negative regulation of lipid metabolic process	IDA	182536
GO:0048261	Process	Negative regulation of receptor-mediated endocytosis	IDA	1917954
GO:0050995	Process	Negative regulation of lipid catabolic process	IBA
GO:0050995	Process	Negative regulation of lipid catabolic process	IDA	15576844
GO:0055102	Function	Lipase inhibitor activity	IDA	182536, 15576844
GO:0060228	Function	Phosphatidylcholine-sterol O-acyltransferase activator activity	TAS	18992221
GO:0070328	Process	Triglyceride homeostasis	IDA	15576844

Other IDs

• MIM: 107710
• HGNC: 607
• e!Ensembl: ENSG00000130208

Protein

• UniProt ID: P02654
• Protein name: Apolipoprotein C-I (Apo-CI) (ApoC-I) (Apolipoprotein C1) [Cleaved into: Truncated apolipoprotein C-I]
• Protein function: Inhibitor of lipoprotein binding to the low density lipoprotein (LDL) receptor, LDL receptor-related protein, and very low density lipoprotein (VLDL) receptor. Associates with high density lipoproteins (HDL) and the triacylglycerol-rich lipoprot
• PDB: 1ALE, 1ALF, 1IOJ, 1OPP, 6DVU, 6DXR, 6DZ6, 6NF3
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF04691	ApoC-I	27 → 82	Apolipoprotein C-I (ApoC-1)	Family

• Tissue specificity: TISSUE SPECIFICITY: Synthesized mainly in liver and to a minor degree in intestine. Also found in the lung and spleen. {ECO:0000269|PubMed:2835369}.
• Sequence:

  MRLFLSLPVLVVVLSIVLEGPAPAQGTPDVSSALDKLKEFGNTLEDKARELISRIKQSEL
  SAKMREWFSETFQKVKEKLKIDS

• Sequence length: 83

Pathways

KEGG:

Cholesterol metabolism

Reactome:

VLDL assembly
VLDL clearance
NR1H3 & NR1H2 regulate gene expression linked to cholesterol transport and efflux