Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	340348
Gene name	Tetraspanin 33
Gene symbol	TSPAN33
Synonyms (NCBI Gene)	PENPEN.TSPAN-33
Chromosome	7
Chromosome location	7q32.1

Show/Hide all (94)

miRTarBase ID	miRNA	Experiments	Reference
MIRT047718	hsa-miR-10a-5p	CLASH	23622248
MIRT047482	hsa-miR-10b-5p	CLASH	23622248
MIRT042265	hsa-miR-484	CLASH	23622248
MIRT1459825	hsa-miR-1207-5p	CLIP-seq
MIRT1459826	hsa-miR-1265	CLIP-seq
MIRT1459827	hsa-miR-1286	CLIP-seq
MIRT1459828	hsa-miR-1471	CLIP-seq
MIRT1459829	hsa-miR-1908	CLIP-seq
MIRT1459830	hsa-miR-19a	CLIP-seq
MIRT1459831	hsa-miR-19b	CLIP-seq
MIRT1459832	hsa-miR-2392	CLIP-seq
MIRT1459833	hsa-miR-3128	CLIP-seq
MIRT1459834	hsa-miR-3192	CLIP-seq
MIRT1459835	hsa-miR-345	CLIP-seq
MIRT1459836	hsa-miR-34c-3p	CLIP-seq
MIRT1459837	hsa-miR-3605-5p	CLIP-seq
MIRT1459838	hsa-miR-3689a-3p	CLIP-seq
MIRT1459839	hsa-miR-3689c	CLIP-seq
MIRT1459840	hsa-miR-4436a	CLIP-seq
MIRT1459841	hsa-miR-4639-3p	CLIP-seq
MIRT1459842	hsa-miR-4714-5p	CLIP-seq
MIRT1459843	hsa-miR-4720-5p	CLIP-seq
MIRT1459844	hsa-miR-4726-3p	CLIP-seq
MIRT1459845	hsa-miR-4728-5p	CLIP-seq
MIRT1459846	hsa-miR-4736	CLIP-seq
MIRT1459847	hsa-miR-4738-5p	CLIP-seq
MIRT1459848	hsa-miR-4763-3p	CLIP-seq
MIRT1459849	hsa-miR-4799-3p	CLIP-seq
MIRT1459850	hsa-miR-486-3p	CLIP-seq
MIRT1459851	hsa-miR-505	CLIP-seq
MIRT1459852	hsa-miR-619	CLIP-seq
MIRT1459853	hsa-miR-663	CLIP-seq
MIRT1459854	hsa-miR-744	CLIP-seq
MIRT1459855	hsa-miR-891b	CLIP-seq
MIRT1555223	hsa-miR-1275	CLIP-seq
MIRT1555224	hsa-miR-3191	CLIP-seq
MIRT1555225	hsa-miR-4525	CLIP-seq
MIRT1555226	hsa-miR-4665-5p	CLIP-seq
MIRT1555227	hsa-miR-4723-5p	CLIP-seq
MIRT1555228	hsa-miR-625	CLIP-seq
MIRT2137983	hsa-miR-10a	CLIP-seq
MIRT2137984	hsa-miR-10b	CLIP-seq
MIRT2137985	hsa-miR-1237	CLIP-seq
MIRT2137986	hsa-miR-1247	CLIP-seq
MIRT2137987	hsa-miR-135a	CLIP-seq
MIRT2137988	hsa-miR-135b	CLIP-seq
MIRT2137989	hsa-miR-136	CLIP-seq
MIRT2137990	hsa-miR-1910	CLIP-seq
MIRT1459830	hsa-miR-19a	CLIP-seq
MIRT1459831	hsa-miR-19b	CLIP-seq
MIRT2137991	hsa-miR-200b	CLIP-seq
MIRT2137992	hsa-miR-200c	CLIP-seq
MIRT2137993	hsa-miR-24	CLIP-seq
MIRT2137994	hsa-miR-3150b-3p	CLIP-seq
MIRT2137995	hsa-miR-3156-3p	CLIP-seq
MIRT2137996	hsa-miR-3670	CLIP-seq
MIRT2137997	hsa-miR-3685	CLIP-seq
MIRT2137998	hsa-miR-3907	CLIP-seq
MIRT2137999	hsa-miR-4264	CLIP-seq
MIRT2138000	hsa-miR-4284	CLIP-seq
MIRT2138001	hsa-miR-429	CLIP-seq
MIRT2138002	hsa-miR-4301	CLIP-seq
MIRT2138003	hsa-miR-4449	CLIP-seq
MIRT2138004	hsa-miR-455-3p	CLIP-seq
MIRT1459847	hsa-miR-4738-5p	CLIP-seq
MIRT2138005	hsa-miR-4784	CLIP-seq
MIRT2138006	hsa-miR-485-5p	CLIP-seq
MIRT2138007	hsa-miR-516b	CLIP-seq
MIRT1459855	hsa-miR-891b	CLIP-seq
MIRT2358909	hsa-miR-138	CLIP-seq
MIRT2358910	hsa-miR-3130-3p	CLIP-seq
MIRT2358911	hsa-miR-323-5p	CLIP-seq
MIRT2358912	hsa-miR-34a	CLIP-seq
MIRT2358913	hsa-miR-34c-5p	CLIP-seq
MIRT2358914	hsa-miR-4266	CLIP-seq
MIRT2358915	hsa-miR-4279	CLIP-seq
MIRT2358916	hsa-miR-4456	CLIP-seq
MIRT2358917	hsa-miR-4487	CLIP-seq
MIRT2358918	hsa-miR-4488	CLIP-seq
MIRT2358919	hsa-miR-449a	CLIP-seq
MIRT2358920	hsa-miR-449b	CLIP-seq
MIRT2358921	hsa-miR-4694-5p	CLIP-seq
MIRT2358922	hsa-miR-4697-5p	CLIP-seq
MIRT2358923	hsa-miR-4793-3p	CLIP-seq
MIRT2358924	hsa-miR-515-3p	CLIP-seq
MIRT2358925	hsa-miR-519e	CLIP-seq
MIRT2358926	hsa-miR-609	CLIP-seq
MIRT2358927	hsa-miR-876-3p	CLIP-seq
MIRT1459830	hsa-miR-19a	CLIP-seq
MIRT1459831	hsa-miR-19b	CLIP-seq
MIRT2396422	hsa-miR-2355-3p	CLIP-seq
MIRT2396423	hsa-miR-4646-3p	CLIP-seq
MIRT1459847	hsa-miR-4738-5p	CLIP-seq
MIRT1459855	hsa-miR-891b	CLIP-seq

Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	23091066, 26686862, 30463011, 32296183, 32814053
GO:0005737	Component	Cytoplasm	IEA
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	23091066
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005912	Component	Adherens junction	IEA
GO:0009986	Component	Cell surface	IEA
GO:0016020	Component	Membrane	IEA
GO:0019899	Function	Enzyme binding	IEA
GO:0019899	Function	Enzyme binding	IPI	23091066
GO:0046930	Component	Pore complex	IEA
GO:0046930	Component	Pore complex	IMP	30463011
GO:0046931	Process	Pore complex assembly	IEA
GO:0046931	Process	Pore complex assembly	IMP	30463011
GO:0051604	Process	Protein maturation	IBA
GO:0051604	Process	Protein maturation	IDA	23091066
GO:0051604	Process	Protein maturation	IEA
GO:0070161	Component	Anchoring junction	IEA
GO:0072659	Process	Protein localization to plasma membrane	IBA
GO:0072659	Process	Protein localization to plasma membrane	IDA	23091066
GO:0072659	Process	Protein localization to plasma membrane	IEA
GO:0097197	Component	Tetraspanin-enriched microdomain	IEA

MIM	HGNC	e!Ensembl
610120	28743	ENSG00000158457

Q86UF1

Protein name

Tetraspanin-33 (Tspan-33) (Penumbra) (hPen) (Proerythroblast new membrane)

Protein function

Part of TspanC8 subgroup, composed of 6 members that interact with the transmembrane metalloprotease ADAM10. This interaction is required for ADAM10 exit from the endoplasmic reticulum and for enzymatic maturation and trafficking to the cell sur

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00335	Tetraspanin	22 → 263	Tetraspanin family	Family

Tissue specificity

TISSUE SPECIFICITY: Predominantly expressed in erythroblasts. {ECO:0000269|PubMed:17158226}.

Sequence

MARRPRAPAASGEEFSFVSPLVKYLLFFFNMLFWVISMVMVAVGVYARLMKHAEAALACL
AVDPAILLIVVGVLMFLLTFCGCIGSLRENICLLQTFSLCLTAVFLLQLAAGILGFVFSD
KARGKVSEIINNAIVHYRDDLDLQNLIDFGQKKFSCCGGISYKDWSQNMYFNCSEDNPSR
ERCSVPYSCCLPTPDQAVINTMCGQGMQAFDYLEASKVIYTNGCIDKLVNWIHSNLFLLG
GVALGLAIPQLVGILLSQILVNQIKDQIKLQLYNQQHRADPWY

Sequence length

283

Interactions

View interactions

	Reactome
			Amyloid fiber formation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (8)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Breast Neoplasms	Associate	32526247	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Associate	25201977	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Associate	26863628	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemic Hyperosmolar Nonketotic Coma	Associate	25201977	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Associate	40305362	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	32526247	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non ST Elevated Myocardial Infarction	Associate	40305362	★★★★★ ★☆☆☆☆ Found in Text Mining only
ST Elevation Myocardial Infarction	Associate	40305362	★★★★★ ★☆☆☆☆ Found in Text Mining only

TSPAN33 (tetraspanin 33)