TREML1 (triggering receptor expressed on myeloid cells like 1)

Gene Gene information from NCBI Gene database.
Gene Gene ontology Other IDs Protein Pathways
Entrez ID 340205
Gene name Triggering receptor expressed on myeloid cells like 1
Gene symbol TREML1
Synonyms (NCBI Gene)
GLTL1825PRO3438TLT-1TLT1dJ238O23.3
Chromosome 6
Chromosome location 6p21.1
Summary This gene encodes a member of the triggering receptor expressed on myeloid cells-like (TREM) family. The encoded protein is a type 1 single Ig domain orphan receptor localized to the alpha-granule membranes of platelets. The encoded protein is involved in
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
22
Gene Gene ontology Other IDs Protein Pathways
Show/Hide all (22)
GO ID Ontology Definition Evidence Reference
GO:0004888 Function Transmembrane signaling receptor activity IBA
GO:0005515 Function Protein binding IPI 15128762, 32296183
GO:0005737 Component Cytoplasm IEA
GO:0005794 Component Golgi apparatus IDA
GO:0005829 Component Cytosol IDA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene Gene ontology Other IDs Protein Pathways
MIM HGNC e!Ensembl
609714 20434 ENSG00000161911
Protein Protein information from UniProt database.
Gene Gene ontology Other IDs Protein Pathways
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q86YW5
Protein name Trem-like transcript 1 protein (TLT-1) (Triggering receptor expressed on myeloid cells-like protein 1)
Protein function Cell surface receptor that may play a role in the innate and adaptive immune response.
PDB 2FRG , 8CHE
Family and domains
Tissue specificity TISSUE SPECIFICITY: Detected in platelets, monocytic leukemia and in T-cell leukemia. {ECO:0000269|PubMed:12645956, ECO:0000269|PubMed:15100151, ECO:0000269|PubMed:15128762, ECO:0000269|PubMed:16505478}.
Sequence 
MGLTLLLLLLLGLEGQGIVGSLPEVLQAPVGSSILVQCHYRLQDVKAQKVWCRFLPEGCQ
PLVSSAVDRRAPAGRRTFLTDLGGGLLQVEMVTLQEEDAGEYGCMVDGARGPQILHRVSL
NILPPEEEEETHKIGSLAENAFSDPAGSANPLEPSQDEKSIPLIWGAVLLVGLLVAAVVL
FAVMAKRKQGNRLGVCGRFLSSRVSGMNPSSVVHHVSDSGPAAELPLDVPHIRLDSPPSF
DNTTYTSLPLDSPSGKPSLPAPSSLPPLPPKVLVCSKPVTYATVIFPGGNKGGGTSCGPA
QNPPNNQTPSS
Sequence length 311
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene Gene ontology Other IDs Protein Pathways
  Reactome
    Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell