TREML1 (triggering receptor expressed on myeloid cells like 1)

Gene
Gene Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
340205
Gene name Gene Name - the full gene name approved by the HGNC.
Triggering receptor expressed on myeloid cells like 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TREML1
Synonyms (NCBI Gene) Gene synonyms aliases
GLTL1825, PRO3438, TLT-1, TLT1, dJ238O23.3
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p21.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the triggering receptor expressed on myeloid cells-like (TREM) family. The encoded protein is a type 1 single Ig domain orphan receptor localized to the alpha-granule membranes of platelets. The encoded protein is involved in
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(14)
GO ID Ontology Definition Evidence Reference
GO:0004888 Function Transmembrane signaling receptor activity IBA 21873635
GO:0005515 Function Protein binding IPI 32296183
GO:0005794 Component Golgi apparatus IDA
GO:0005829 Component Cytosol IDA
GO:0005886 Component Plasma membrane IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
609714 20434 ENSG00000161911
Protein
Gene Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q86YW5
Protein name Trem-like transcript 1 protein (TLT-1) (Triggering receptor expressed on myeloid cells-like protein 1)
Protein function Cell surface receptor that may play a role in the innate and adaptive immune response.
PDB 2FRG , 8CHE
Family and domains
Tissue specificity TISSUE SPECIFICITY: Detected in platelets, monocytic leukemia and in T-cell leukemia. {ECO:0000269|PubMed:12645956, ECO:0000269|PubMed:15100151, ECO:0000269|PubMed:15128762, ECO:0000269|PubMed:16505478}.
Sequence 
MGLTLLLLLLLGLEGQGIVGSLPEVLQAPVGSSILVQCHYRLQDVKAQKVWCRFLPEGCQ
PLVSSAVDRRAPAGRRTFLTDLGGGLLQVEMVTLQEEDAGEYGCMVDGARGPQILHRVSL
NILPPEEEEETHKIGSLAENAFSDPAGSANPLEPSQDEKSIPLIWGAVLLVGLLVAAVVL
FAVMAKRKQGNRLGVCGRFLSSRVSGMNPSSVVHHVSDSGPAAELPLDVPHIRLDSPPSF
DNTTYTSLPLDSPSGKPSLPAPSSLPPLPPKVLVCSKPVTYATVIFPGGNKGGGTSCGPA
QNPPNNQTPSS
Sequence length 311
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (2)
Causal
Disease term Disease name dbSNP ID References
Arthritis Juvenile arthritis rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470 19565504
Breast cancer Malignant neoplasm of breast rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158
View all (309 more)
Show/Hide Text Mining Associations (11)
Associations from Text Mining
Disease Name Relationship Type References
Alzheimer Disease Associate 38511601
Gray Platelet Syndrome Associate 18612537
Leukemia Myeloid Acute Associate 30545930
Lymphatic Metastasis Associate 31348270
Neuroinflammatory Diseases Associate 37348876
Parkinson Disease Associate 37348876
Platelet Disorder Familial with Associated Myeloid Malignancy Associate 30545930
Polycystic Ovary Syndrome Inhibit 37854181
Postural Orthostatic Tachycardia Syndrome Associate 40022872
Prostatic Neoplasms Associate 31348270