Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
340152
Gene name Gene Name - the full gene name approved by the HGNC.
Zinc finger CCCH-type containing 12D
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ZC3H12D
Synonyms (NCBI Gene) Gene synonyms aliases
C6orf95, MCPIP4, TFL, dJ281H8.1, p34
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6q25.1
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT1505515 hsa-miR-106a CLIP-seq
MIRT1505516 hsa-miR-106b CLIP-seq
MIRT1505517 hsa-miR-1200 CLIP-seq
MIRT1505518 hsa-miR-1207-5p CLIP-seq
MIRT1505519 hsa-miR-1245 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000932 Component P-body IDA 24415781, 26134560
GO:0000932 Component P-body IEA
GO:0003729 Function MRNA binding IBA
GO:0004518 Function Nuclease activity IEA
GO:0004519 Function Endonuclease activity IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
611106 21175 ENSG00000178199
Protein
UniProt ID A2A288
Protein name Probable ribonuclease ZC3H12D (EC 3.1.-.-) (MCP-induced protein 4) (Transformed follicular lymphoma) (Zinc finger CCCH domain-containing protein 12D) (p34)
Protein function May regulate cell growth likely by suppressing RB1 phosphorylation (PubMed:19531561). May function as RNase and regulate the levels of target RNA species (Potential). In association with ZC3H12A enhances the degradation of interleukin IL-6 mRNA
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF18039 UBA_6 3 44 UBA-like domain Domain
PF11977 RNase_Zc3h12a 88 244 Zc3h12a-like Ribonuclease NYN domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in normal human lymphocytes but defective in some leukemia/lymphoma cell lines. {ECO:0000269|PubMed:19531561}.
Sequence
MEHPSKMEFFQKLGYDREDVLRVLGKLGEGALVNDVLQELIRTGSRPGALEHPAAPRLVP
RGSCGVPDSAQRGPGTALEEDFRTLASSLRPIVIDGSNVAMSHGNKETFSCRGIKLAVDW
FRDRGHTYIKVFVPSWRKDPPRADTPIREQHVLAELERQAVLVYTPSRKVHGKRLVCYDD
RYIVKVAYEQDGVIVSNDNYRDLQSENPEWKWFIEQRLLMFSFVNDRFMPPDDPLGRHGP
SLSN
FLSRKPKPPEPSWQHCPYGKKCTYGIKCKFYHPERPHHAQLAVADELRAKTGARPG
AGAEEQRPPRAPGGSAGARAAPREPFAHSLPPARGSPDLAALRGSFSRLAFSDDLGPLGP
PLPVPACSLTPRLGGPDWVSAGGRVPGPLSLPSPESQFSPGDLPPPPGLQLQPRGEHRPR
DLHGDLLSPRRPPDDPWARPPRSDRFPGRSVWAEPAWGDGATGGLSVYATEDDEGDARAR
ARIALYSVFPRDQVDRVMAAFPELSDLARLILLVQRCQSAGAPLGKP
Sequence length 527
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Asthma Asthma N/A N/A GWAS
Coronary artery disease Coronary artery disease N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 35090416
Carcinoma Hepatocellular Associate 34545456
Lung Neoplasms Associate 35090416
Lymphoma B Cell Associate 36240289
Lymphoma Follicular Associate 36240289
Lymphoma Large B Cell Diffuse Associate 36240289
Squamous Cell Carcinoma of Head and Neck Associate 34585646, 39907408