TRIML1 (tripartite motif family like 1)

Gene Gene information from NCBI Gene database.
Gene Gene ontology Other IDs Protein Associated diseases
Entrez ID 339976
Gene name Tripartite motif family like 1
Gene symbol TRIML1
Synonyms (NCBI Gene)
RNF209
Chromosome 4
Chromosome location 4q35.2
Summary The protein encoded by this gene is a tripartite motif family protein with similarities to E3 ubiquitin-protein ligases. While the function of the encoded protein has not been determined, the orthologous protein in mouse has been shown to bind ubiquitin-s
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
9
Gene Gene ontology Other IDs Protein Associated diseases
Show/Hide all (9)
GO ID Ontology Definition Evidence Reference
GO:0005737 Component Cytoplasm IBA
GO:0005737 Component Cytoplasm IEA
GO:0008270 Function Zinc ion binding IEA
GO:0016567 Process Protein ubiquitination IEA
GO:0016740 Function Transferase activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
620979 26698 ENSG00000184108
Protein Protein information from UniProt database.
Gene Gene ontology Other IDs Protein Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8N9V2
Protein name Probable E3 ubiquitin-protein ligase TRIML1 (EC 2.3.2.27) (RING finger protein 209) (RING-type E3 ubiquitin transferase TRIML1) (Tripartite motif family-like protein 1)
Protein function Probable E3 ubiquitin-protein ligase which plays an important role in blastocyst development.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15227 zf-C3HC4_4 16 → 56 Domain
PF13765 PRY 288 → 336 SPRY-associated domain Family
PF00622 SPRY 340 → 456 SPRY domain Family
Sequence 
MSTADLMENLREELTCFICLDYFSSPVTTECGHSFCLVCLLRSWEEHNTPLSCPECWRTL
EGPHFQSNERLGRLASIARQLRSQVLQSEDEQGSYGRMPTTAKALSDDEQGGSAFVAQSH
GANRVHLSSEAEEHHREKLQEILNLLRVRRKEAQAVLTHEKERVKLCQEETKTCKQVVVS
EYMKMHQFLKEEEQLQLQLLEQEEKENMRKLRNNEIKLTQQIRSLSKMIAQIESSSQSSA
FESLEEVRGALERSEPLLLQCPEATTTELSLCRITGMKEMLRKFSTEITLDPATANAYLV
LSEDLKSVKYGGSRQQLPDNPERFDQSATVLGTQIFTSGRHYWEVEVGNKTEWEVGICKD
SVSRKGNLPKPPGDLFSLIGLKIGDDYSLWVSSPLKGQHVREPVCKVGVFLDYESGHIAF
YNGTDESLIYSFPQASFQEALRPIFSPCLPNEGTNTDPLTICSLNSHV
Sequence length 468
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Gene Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Prostate cancer Uncertain significance rs193920871 RCV000149375