Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3399
Gene name Gene Name - the full gene name approved by the HGNC.
Inhibitor of DNA binding 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ID3
Synonyms (NCBI Gene) Gene synonyms aliases
HEIR-1, bHLHb25
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1p36.12
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a helix-loop-helix (HLH) protein that can form heterodimers with other HLH proteins. However, the encoded protein lacks a basic DNA-binding domain and therefore inhibits the DNA binding of any HLH protein with which it
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT004740 hsa-miR-520h Microarray, qRT-PCR 19435428
MIRT022266 hsa-miR-124-3p Microarray 18668037
MIRT657245 hsa-miR-634 HITS-CLIP 23824327
MIRT657244 hsa-miR-7151-5p HITS-CLIP 23824327
MIRT657243 hsa-miR-205-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IBA 21873635
GO:0000122 Process Negative regulation of transcription by RNA polymerase II TAS 25248477
GO:0001656 Process Metanephros development IEA
GO:0005515 Function Protein binding IPI 18255255, 20861012, 25416956, 25609649, 28514442, 31515488, 32296183, 32814053
GO:0005634 Component Nucleus IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
600277 5362 ENSG00000117318
Protein
UniProt ID Q02535
Protein name DNA-binding protein inhibitor ID-3 (Class B basic helix-loop-helix protein 25) (bHLHb25) (Helix-loop-helix protein HEIR-1) (ID-like protein inhibitor HLH 1R21) (Inhibitor of DNA binding 3) (Inhibitor of differentiation 3)
Protein function Transcriptional regulator (lacking a basic DNA binding domain) which negatively regulates the basic helix-loop-helix (bHLH) transcription factors by forming heterodimers and inhibiting their DNA binding and transcriptional activity. Implicated i
PDB 2LFH
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00010 HLH 40 81 Helix-loop-helix DNA-binding domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed abundantly in lung, kidney and adrenal gland, but not in adult brain.
Sequence
MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPR
GTQLSQVEILQRVIDYILDLQ
VVLAEPAPGPPDGPHLPIQTAELTPELVISNDKRSFCH
Sequence length 119
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  TGF-beta signaling pathway
Signaling pathways regulating pluripotency of stem cells
  NGF-stimulated transcription
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Adenocarcinoma Adenocarcinoma, Adenocarcinoma, Basal Cell, Adenocarcinoma, Oxyphilic, Adenocarcinoma, Tubular rs121913530, rs886039394, rs121913474 21552421
Burkitt`s lymphoma Burkitt Lymphoma, Burkitt Leukemia rs28933407, rs121918683, rs121918684 23143597, 23143595
Carcinoma Carcinoma, Carcinoma, Cribriform, Carcinoma, Granular Cell, Carcinoma, Spindle-Cell, Undifferentiated carcinoma rs121912654, rs555607708, rs786202962, rs1564055259 12376462, 21552421
Colonic neoplasms Malignant tumor of colon, Colonic Neoplasms rs267607789, rs774277300, rs781222233, rs1060502734, rs1060503333, rs1339238483 15059925
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 22151756, 26869608
Azoospermia Associate 25977194
Biliary Tract Neoplasms Associate 24409060
Breast Neoplasms Inhibit 30066902
Breast Neoplasms Associate 32661241
Burkitt Lymphoma Associate 22885699, 22967991, 23143597, 26437030, 26468873, 26712879, 28209658, 28724958, 30567752, 31738823, 34472720, 35794096, 36201743, 37053555, 40572059
Carcinogenesis Associate 23342268, 24343358
Carcinoma Acinar Cell Associate 29109526
Carcinoma Lobular Associate 32661241
Carcinoma Non Small Cell Lung Associate 23311395