Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3399
Gene name	Inhibitor of DNA binding 3
Gene symbol	ID3
Synonyms (NCBI Gene)	HEIR-1bHLHb25
Chromosome	1
Chromosome location	1p36.12
Summary	The protein encoded by this gene is a helix-loop-helix (HLH) protein that can form heterodimers with other HLH proteins. However, the encoded protein lacks a basic DNA-binding domain and therefore inhibits the DNA binding of any HLH protein with which it

216

Show/Hide all (216)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004740	hsa-miR-520h	MicroarrayqRT-PCR	19435428
MIRT022266	hsa-miR-124-3p	Microarray	18668037
MIRT657245	hsa-miR-634	HITS-CLIP	23824327
MIRT657244	hsa-miR-7151-5p	HITS-CLIP	23824327
MIRT657243	hsa-miR-205-3p	HITS-CLIP	23824327
MIRT657242	hsa-miR-4762-5p	HITS-CLIP	23824327
MIRT657241	hsa-miR-338-3p	HITS-CLIP	23824327
MIRT455442	hsa-miR-4476	PAR-CLIP	23592263
MIRT455441	hsa-miR-6876-5p	PAR-CLIP	23592263
MIRT455440	hsa-miR-5002-5p	PAR-CLIP	23592263
MIRT455439	hsa-miR-6513-3p	PAR-CLIP	23592263
MIRT455438	hsa-miR-665	PAR-CLIP	23592263
MIRT455437	hsa-miR-766-3p	PAR-CLIP	23592263
MIRT455436	hsa-miR-3925-3p	PAR-CLIP	23592263
MIRT455434	hsa-miR-7515	PAR-CLIP	23592263
MIRT455435	hsa-miR-6132	PAR-CLIP	23592263
MIRT455433	hsa-miR-6836-5p	PAR-CLIP	23592263
MIRT455432	hsa-miR-3202	PAR-CLIP	23592263
MIRT455431	hsa-miR-1207-5p	PAR-CLIP	23592263
MIRT455430	hsa-miR-4763-3p	PAR-CLIP	23592263
MIRT455429	hsa-miR-6721-5p	PAR-CLIP	23592263
MIRT455428	hsa-miR-4474-5p	PAR-CLIP	23592263
MIRT455427	hsa-miR-7855-5p	PAR-CLIP	23592263
MIRT455436	hsa-miR-3925-3p	PAR-CLIP	26701625
MIRT455428	hsa-miR-4474-5p	PAR-CLIP	26701625
MIRT455437	hsa-miR-766-3p	PAR-CLIP	26701625
MIRT657245	hsa-miR-634	HITS-CLIP	23824327
MIRT657244	hsa-miR-7151-5p	HITS-CLIP	23824327
MIRT657243	hsa-miR-205-3p	HITS-CLIP	23824327
MIRT657242	hsa-miR-4762-5p	HITS-CLIP	23824327
MIRT657241	hsa-miR-338-3p	HITS-CLIP	23824327
MIRT455442	hsa-miR-4476	PAR-CLIP	23592263
MIRT455441	hsa-miR-6876-5p	PAR-CLIP	23592263
MIRT455440	hsa-miR-5002-5p	PAR-CLIP	23592263
MIRT455439	hsa-miR-6513-3p	PAR-CLIP	23592263
MIRT455438	hsa-miR-665	PAR-CLIP	23592263
MIRT455437	hsa-miR-766-3p	PAR-CLIP	23592263
MIRT455436	hsa-miR-3925-3p	PAR-CLIP	23592263
MIRT455434	hsa-miR-7515	PAR-CLIP	23592263
MIRT455435	hsa-miR-6132	PAR-CLIP	23592263
MIRT455433	hsa-miR-6836-5p	PAR-CLIP	23592263
MIRT455432	hsa-miR-3202	PAR-CLIP	23592263
MIRT455431	hsa-miR-1207-5p	PAR-CLIP	23592263
MIRT455430	hsa-miR-4763-3p	PAR-CLIP	23592263
MIRT455429	hsa-miR-6721-5p	PAR-CLIP	23592263
MIRT455428	hsa-miR-4474-5p	PAR-CLIP	23592263
MIRT455427	hsa-miR-7855-5p	PAR-CLIP	23592263
MIRT1059008	hsa-miR-1180	CLIP-seq
MIRT1059009	hsa-miR-1228	CLIP-seq
MIRT1059010	hsa-miR-1270	CLIP-seq
MIRT1059011	hsa-miR-1275	CLIP-seq
MIRT1059012	hsa-miR-128	CLIP-seq
MIRT1059013	hsa-miR-185	CLIP-seq
MIRT1059014	hsa-miR-1910	CLIP-seq
MIRT1059015	hsa-miR-1972	CLIP-seq
MIRT1059016	hsa-miR-224	CLIP-seq
MIRT1059017	hsa-miR-2278	CLIP-seq
MIRT1059018	hsa-miR-27a	CLIP-seq
MIRT1059019	hsa-miR-27b	CLIP-seq
MIRT1059020	hsa-miR-29a	CLIP-seq
MIRT1059021	hsa-miR-29b	CLIP-seq
MIRT1059022	hsa-miR-29c	CLIP-seq
MIRT1059023	hsa-miR-3127-5p	CLIP-seq
MIRT1059024	hsa-miR-3163	CLIP-seq
MIRT1059025	hsa-miR-340	CLIP-seq
MIRT1059026	hsa-miR-342-5p	CLIP-seq
MIRT1059027	hsa-miR-3667-3p	CLIP-seq
MIRT1059028	hsa-miR-3692	CLIP-seq
MIRT1059029	hsa-miR-3918	CLIP-seq
MIRT1059030	hsa-miR-4259	CLIP-seq
MIRT1059031	hsa-miR-4260	CLIP-seq
MIRT1059032	hsa-miR-4300	CLIP-seq
MIRT1059033	hsa-miR-4306	CLIP-seq
MIRT1059034	hsa-miR-4531	CLIP-seq
MIRT1059035	hsa-miR-4532	CLIP-seq
MIRT1059036	hsa-miR-4644	CLIP-seq
MIRT1059037	hsa-miR-4650-5p	CLIP-seq
MIRT1059038	hsa-miR-4651	CLIP-seq
MIRT1059039	hsa-miR-4664-5p	CLIP-seq
MIRT1059040	hsa-miR-4665-5p	CLIP-seq
MIRT1059041	hsa-miR-4691-3p	CLIP-seq
MIRT1059042	hsa-miR-4709-3p	CLIP-seq
MIRT1059043	hsa-miR-4717-5p	CLIP-seq
MIRT1059044	hsa-miR-4722-5p	CLIP-seq
MIRT1059045	hsa-miR-4768-3p	CLIP-seq
MIRT1059046	hsa-miR-483-3p	CLIP-seq
MIRT1059047	hsa-miR-513a-5p	CLIP-seq
MIRT1059048	hsa-miR-561	CLIP-seq
MIRT1059049	hsa-miR-608	CLIP-seq
MIRT1059050	hsa-miR-615-5p	CLIP-seq
MIRT1059051	hsa-miR-620	CLIP-seq
MIRT1059052	hsa-miR-766	CLIP-seq
MIRT1059053	hsa-miR-769-5p	CLIP-seq
MIRT1059054	hsa-miR-889	CLIP-seq
MIRT1059055	hsa-miR-920	CLIP-seq
MIRT1059027	hsa-miR-3667-3p	CLIP-seq
MIRT1549714	hsa-miR-4632	CLIP-seq
MIRT1059008	hsa-miR-1180	CLIP-seq
MIRT2013769	hsa-miR-1181	CLIP-seq
MIRT2013770	hsa-miR-1207-3p	CLIP-seq
MIRT1059012	hsa-miR-128	CLIP-seq
MIRT2013771	hsa-miR-138	CLIP-seq
MIRT2013772	hsa-miR-149	CLIP-seq
MIRT1059014	hsa-miR-1910	CLIP-seq
MIRT2013773	hsa-miR-1915	CLIP-seq
MIRT1059015	hsa-miR-1972	CLIP-seq
MIRT1059018	hsa-miR-27a	CLIP-seq
MIRT1059019	hsa-miR-27b	CLIP-seq
MIRT1059020	hsa-miR-29a	CLIP-seq
MIRT1059021	hsa-miR-29b	CLIP-seq
MIRT1059022	hsa-miR-29c	CLIP-seq
MIRT2013774	hsa-miR-3064-5p	CLIP-seq
MIRT1059027	hsa-miR-3667-3p	CLIP-seq
MIRT1059030	hsa-miR-4259	CLIP-seq
MIRT1059032	hsa-miR-4300	CLIP-seq
MIRT2013775	hsa-miR-4435	CLIP-seq
MIRT2013776	hsa-miR-4456	CLIP-seq
MIRT2013777	hsa-miR-4514	CLIP-seq
MIRT1059035	hsa-miR-4532	CLIP-seq
MIRT2013778	hsa-miR-4645-5p	CLIP-seq
MIRT1059037	hsa-miR-4650-5p	CLIP-seq
MIRT2013779	hsa-miR-4673	CLIP-seq
MIRT2013780	hsa-miR-4692	CLIP-seq
MIRT1059043	hsa-miR-4717-5p	CLIP-seq
MIRT1059044	hsa-miR-4722-5p	CLIP-seq
MIRT2013781	hsa-miR-4726-3p	CLIP-seq
MIRT1059045	hsa-miR-4768-3p	CLIP-seq
MIRT2013782	hsa-miR-4794	CLIP-seq
MIRT1059047	hsa-miR-513a-5p	CLIP-seq
MIRT1059050	hsa-miR-615-5p	CLIP-seq
MIRT2013783	hsa-miR-760	CLIP-seq
MIRT1059052	hsa-miR-766	CLIP-seq
MIRT1059055	hsa-miR-920	CLIP-seq
MIRT1059023	hsa-miR-3127-5p	CLIP-seq
MIRT2245895	hsa-miR-3194-3p	CLIP-seq
MIRT1059029	hsa-miR-3918	CLIP-seq
MIRT2245896	hsa-miR-4267	CLIP-seq
MIRT1549714	hsa-miR-4632	CLIP-seq
MIRT2245897	hsa-miR-4642	CLIP-seq
MIRT1059008	hsa-miR-1180	CLIP-seq
MIRT2013769	hsa-miR-1181	CLIP-seq
MIRT2013770	hsa-miR-1207-3p	CLIP-seq
MIRT1059012	hsa-miR-128	CLIP-seq
MIRT2437689	hsa-miR-1299	CLIP-seq
MIRT2013771	hsa-miR-138	CLIP-seq
MIRT2013772	hsa-miR-149	CLIP-seq
MIRT1059014	hsa-miR-1910	CLIP-seq
MIRT2013773	hsa-miR-1915	CLIP-seq
MIRT1059015	hsa-miR-1972	CLIP-seq
MIRT1059018	hsa-miR-27a	CLIP-seq
MIRT1059019	hsa-miR-27b	CLIP-seq
MIRT1059020	hsa-miR-29a	CLIP-seq
MIRT1059021	hsa-miR-29b	CLIP-seq
MIRT1059022	hsa-miR-29c	CLIP-seq
MIRT2013774	hsa-miR-3064-5p	CLIP-seq
MIRT2437690	hsa-miR-3065-3p	CLIP-seq
MIRT2437691	hsa-miR-3193	CLIP-seq
MIRT2437692	hsa-miR-3689d	CLIP-seq
MIRT1059030	hsa-miR-4259	CLIP-seq
MIRT1059031	hsa-miR-4260	CLIP-seq
MIRT2013775	hsa-miR-4435	CLIP-seq
MIRT2013776	hsa-miR-4456	CLIP-seq
MIRT2013777	hsa-miR-4514	CLIP-seq
MIRT1059035	hsa-miR-4532	CLIP-seq
MIRT2013778	hsa-miR-4645-5p	CLIP-seq
MIRT1059037	hsa-miR-4650-5p	CLIP-seq
MIRT2013779	hsa-miR-4673	CLIP-seq
MIRT2013780	hsa-miR-4692	CLIP-seq
MIRT1059044	hsa-miR-4722-5p	CLIP-seq
MIRT2013781	hsa-miR-4726-3p	CLIP-seq
MIRT1059045	hsa-miR-4768-3p	CLIP-seq
MIRT2437693	hsa-miR-4782-5p	CLIP-seq
MIRT2013782	hsa-miR-4794	CLIP-seq
MIRT1059047	hsa-miR-513a-5p	CLIP-seq
MIRT2437694	hsa-miR-516b	CLIP-seq
MIRT1059050	hsa-miR-615-5p	CLIP-seq
MIRT2013783	hsa-miR-760	CLIP-seq
MIRT1059052	hsa-miR-766	CLIP-seq
MIRT1059011	hsa-miR-1275	CLIP-seq
MIRT1059026	hsa-miR-342-5p	CLIP-seq
MIRT1059038	hsa-miR-4651	CLIP-seq
MIRT1059039	hsa-miR-4664-5p	CLIP-seq
MIRT1059040	hsa-miR-4665-5p	CLIP-seq
MIRT1059049	hsa-miR-608	CLIP-seq
MIRT2013769	hsa-miR-1181	CLIP-seq
MIRT2013770	hsa-miR-1207-3p	CLIP-seq
MIRT1059009	hsa-miR-1228	CLIP-seq
MIRT1059011	hsa-miR-1275	CLIP-seq
MIRT1059012	hsa-miR-128	CLIP-seq
MIRT2013771	hsa-miR-138	CLIP-seq
MIRT2013772	hsa-miR-149	CLIP-seq
MIRT1059014	hsa-miR-1910	CLIP-seq
MIRT1059015	hsa-miR-1972	CLIP-seq
MIRT1059018	hsa-miR-27a	CLIP-seq
MIRT1059019	hsa-miR-27b	CLIP-seq
MIRT1059020	hsa-miR-29a	CLIP-seq
MIRT1059021	hsa-miR-29b	CLIP-seq
MIRT1059022	hsa-miR-29c	CLIP-seq
MIRT2013774	hsa-miR-3064-5p	CLIP-seq
MIRT1059026	hsa-miR-342-5p	CLIP-seq
MIRT1059032	hsa-miR-4300	CLIP-seq
MIRT2013775	hsa-miR-4435	CLIP-seq
MIRT2013776	hsa-miR-4456	CLIP-seq
MIRT1059037	hsa-miR-4650-5p	CLIP-seq
MIRT1059038	hsa-miR-4651	CLIP-seq
MIRT1059039	hsa-miR-4664-5p	CLIP-seq
MIRT1059040	hsa-miR-4665-5p	CLIP-seq
MIRT1059042	hsa-miR-4709-3p	CLIP-seq
MIRT1059043	hsa-miR-4717-5p	CLIP-seq
MIRT2013782	hsa-miR-4794	CLIP-seq
MIRT1059047	hsa-miR-513a-5p	CLIP-seq
MIRT1059049	hsa-miR-608	CLIP-seq
MIRT2013783	hsa-miR-760	CLIP-seq
MIRT1059052	hsa-miR-766	CLIP-seq
MIRT1059053	hsa-miR-769-5p	CLIP-seq
MIRT1059055	hsa-miR-920	CLIP-seq

Show/Hide all (38)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	TAS	25248477
GO:0001656	Process	Metanephros development	IEA
GO:0003714	Function	Transcription corepressor activity	IBA
GO:0005515	Function	Protein binding	IPI	18255255, 20211142, 20861012, 25416956, 25609649, 28514442, 31515488, 32296183, 32814053, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IC	14627819
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0006275	Process	Regulation of DNA replication	IEA
GO:0007417	Process	Central nervous system development	IEA
GO:0007507	Process	Heart development	IEA
GO:0007517	Process	Muscle organ development	IEA
GO:0007623	Process	Circadian rhythm	IEA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0019904	Function	Protein domain specific binding	IEA
GO:0030182	Process	Neuron differentiation	IBA
GO:0030182	Process	Neuron differentiation	IEA
GO:0030855	Process	Epithelial cell differentiation	IEA
GO:0030903	Process	Notochord development	IEA
GO:0042476	Process	Odontogenesis	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043425	Function	BHLH transcription factor binding	IEA
GO:0043433	Process	Negative regulation of DNA-binding transcription factor activity	IDA	14627819
GO:0045662	Process	Negative regulation of myoblast differentiation	IEA
GO:0045668	Process	Negative regulation of osteoblast differentiation	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	14627819
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0046983	Function	Protein dimerization activity	IEA
GO:0048511	Process	Rhythmic process	IEA
GO:0072750	Process	Cellular response to leptomycin B	IEA
GO:0140416	Function	Transcription regulator inhibitor activity	IEA
GO:0140416	Function	Transcription regulator inhibitor activity	TAS	25248477
GO:1901707	Function	Leptomycin B binding	IEA

MIM	HGNC	e!Ensembl
600277	5362	ENSG00000117318

Q02535

Protein name

DNA-binding protein inhibitor ID-3 (Class B basic helix-loop-helix protein 25) (bHLHb25) (Helix-loop-helix protein HEIR-1) (ID-like protein inhibitor HLH 1R21) (Inhibitor of DNA binding 3) (Inhibitor of differentiation 3)

Protein function

Transcriptional regulator (lacking a basic DNA binding domain) which negatively regulates the basic helix-loop-helix (bHLH) transcription factors by forming heterodimers and inhibiting their DNA binding and transcriptional activity. Implicated i

PDB

2LFH

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00010	HLH	40 → 81	Helix-loop-helix DNA-binding domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed abundantly in lung, kidney and adrenal gland, but not in adult brain.

Sequence

MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPR
GTQLSQVEILQRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAELTPELVISNDKRSFCH

Sequence length

119

Interactions

View interactions

	KEGG		Reactome
	TGF-beta signaling pathway Signaling pathways regulating pluripotency of stem cells		NGF-stimulated transcription

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Hereditary breast ovarian cancer syndrome	Uncertain significance	rs146163818	RCV001374523

Show/Hide Text Mining Associations (54)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	22151756, 26869608
Azoospermia	Associate	25977194
Biliary Tract Neoplasms	Associate	24409060
Breast Neoplasms	Inhibit	30066902
Breast Neoplasms	Associate	32661241
Burkitt Lymphoma	Associate	22885699, 22967991, 23143597, 26437030, 26468873, 26712879, 28209658, 28724958, 30567752, 31738823, 34472720, 35794096, 36201743, 37053555, 40572059
Carcinogenesis	Associate	23342268, 24343358
Carcinoma Acinar Cell	Associate	29109526
Carcinoma Lobular	Associate	32661241
Carcinoma Non Small Cell Lung	Associate	23311395
Cardio Renal Syndrome	Associate	25129100
Colonic Neoplasms	Associate	18513385
Colorectal Neoplasms	Associate	28767654
Constriction Pathologic	Associate	24603695
Coronary Aneurysm	Associate	24603695
Coronary Artery Disease	Associate	24603695, 33271747
Death	Stimulate	26869608
Depressive Disorder	Associate	24655651
Diabetes Mellitus	Associate	24603695
Endometriosis	Associate	25207642, 36232817
Fluorosis Dental	Associate	29317700
Glioblastoma	Associate	28767654
Heredodegenerative Disorders Nervous System	Associate	25129100
Kashin Beck Disease	Associate	29317700
Leukemia	Associate	25644253
Leukemia Biphenotypic Acute	Associate	39676870
Leukemia Erythroblastic Acute	Associate	9525934
Leukemia Lymphocytic Chronic B Cell	Associate	25644253, 29196338
Leukemia Myeloid Acute	Inhibit	36443709
Lung Neoplasms	Associate	23593444, 32003423
Lupus Erythematosus Systemic	Associate	35757721
Lymphatic Metastasis	Stimulate	26869608
Lymphoma B Cell	Associate	28209658, 31738823, 32981916
Lymphoma B Cell Marginal Zone	Associate	37941429
Lymphoma Large B Cell Diffuse	Associate	22967991
Medulloblastoma	Associate	23397264
Melanoma	Associate	24343358, 39273240
Microvascular Angina	Associate	25129100
Myositis Ossificans	Associate	16753021
Neoplasm Metastasis	Inhibit	23311395
Neoplasm Metastasis	Associate	24122992, 26869608, 39342788
Neoplasms	Associate	22151756, 23397264, 23593444, 24122992, 25778840, 34597852, 34718742, 39676870
Neoplasms	Inhibit	23143597, 29109526
Neuroblastoma	Associate	7777541
Ovarian Neoplasms	Associate	11161400, 20842131
Ovarian Neoplasms	Inhibit	18513385
Pancreatic Neoplasms	Stimulate	18513385
Plaque Atherosclerotic	Associate	24603695
Prodromal Symptoms	Associate	23311395
Prostatic Neoplasms	Associate	23060149, 23342267, 23342268
Pyruvate Carboxylase Deficiency Disease	Associate	23143597
Sarcoma Ewing	Associate	40607387
Stroke	Associate	31391037
Vitamin D Deficiency	Associate	34597852

ID3 (inhibitor of DNA binding 3)