Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3399
Gene name Gene Name - the full gene name approved by the HGNC.	Inhibitor of DNA binding 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ID3
Synonyms (NCBI Gene) Gene synonyms aliases	HEIR-1, bHLHb25
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1p36.12
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a helix-loop-helix (HLH) protein that can form heterodimers with other HLH proteins. However, the encoded protein lacks a basic DNA-binding domain and therefore inhibits the DNA binding of any HLH protein with which it

Show/Hide all(216)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004740	hsa-miR-520h	Microarray, qRT-PCR	19435428
MIRT022266	hsa-miR-124-3p	Microarray	18668037
MIRT657245	hsa-miR-634	HITS-CLIP	23824327
MIRT657244	hsa-miR-7151-5p	HITS-CLIP	23824327
MIRT657243	hsa-miR-205-3p	HITS-CLIP	23824327
MIRT657242	hsa-miR-4762-5p	HITS-CLIP	23824327
MIRT657241	hsa-miR-338-3p	HITS-CLIP	23824327
MIRT455442	hsa-miR-4476	PAR-CLIP	23592263
MIRT455441	hsa-miR-6876-5p	PAR-CLIP	23592263
MIRT455440	hsa-miR-5002-5p	PAR-CLIP	23592263
MIRT455439	hsa-miR-6513-3p	PAR-CLIP	23592263
MIRT455438	hsa-miR-665	PAR-CLIP	23592263
MIRT455437	hsa-miR-766-3p	PAR-CLIP	23592263
MIRT455436	hsa-miR-3925-3p	PAR-CLIP	23592263
MIRT455434	hsa-miR-7515	PAR-CLIP	23592263
MIRT455435	hsa-miR-6132	PAR-CLIP	23592263
MIRT455433	hsa-miR-6836-5p	PAR-CLIP	23592263
MIRT455432	hsa-miR-3202	PAR-CLIP	23592263
MIRT455431	hsa-miR-1207-5p	PAR-CLIP	23592263
MIRT455430	hsa-miR-4763-3p	PAR-CLIP	23592263
MIRT455429	hsa-miR-6721-5p	PAR-CLIP	23592263
MIRT455428	hsa-miR-4474-5p	PAR-CLIP	23592263
MIRT455427	hsa-miR-7855-5p	PAR-CLIP	23592263
MIRT455436	hsa-miR-3925-3p	PAR-CLIP	26701625
MIRT455428	hsa-miR-4474-5p	PAR-CLIP	26701625
MIRT455437	hsa-miR-766-3p	PAR-CLIP	26701625
MIRT657245	hsa-miR-634	HITS-CLIP	23824327
MIRT657244	hsa-miR-7151-5p	HITS-CLIP	23824327
MIRT657243	hsa-miR-205-3p	HITS-CLIP	23824327
MIRT657242	hsa-miR-4762-5p	HITS-CLIP	23824327
MIRT657241	hsa-miR-338-3p	HITS-CLIP	23824327
MIRT455442	hsa-miR-4476	PAR-CLIP	23592263
MIRT455441	hsa-miR-6876-5p	PAR-CLIP	23592263
MIRT455440	hsa-miR-5002-5p	PAR-CLIP	23592263
MIRT455439	hsa-miR-6513-3p	PAR-CLIP	23592263
MIRT455438	hsa-miR-665	PAR-CLIP	23592263
MIRT455437	hsa-miR-766-3p	PAR-CLIP	23592263
MIRT455436	hsa-miR-3925-3p	PAR-CLIP	23592263
MIRT455434	hsa-miR-7515	PAR-CLIP	23592263
MIRT455435	hsa-miR-6132	PAR-CLIP	23592263
MIRT455433	hsa-miR-6836-5p	PAR-CLIP	23592263
MIRT455432	hsa-miR-3202	PAR-CLIP	23592263
MIRT455431	hsa-miR-1207-5p	PAR-CLIP	23592263
MIRT455430	hsa-miR-4763-3p	PAR-CLIP	23592263
MIRT455429	hsa-miR-6721-5p	PAR-CLIP	23592263
MIRT455428	hsa-miR-4474-5p	PAR-CLIP	23592263
MIRT455427	hsa-miR-7855-5p	PAR-CLIP	23592263
MIRT1059008	hsa-miR-1180	CLIP-seq
MIRT1059009	hsa-miR-1228	CLIP-seq
MIRT1059010	hsa-miR-1270	CLIP-seq
MIRT1059011	hsa-miR-1275	CLIP-seq
MIRT1059012	hsa-miR-128	CLIP-seq
MIRT1059013	hsa-miR-185	CLIP-seq
MIRT1059014	hsa-miR-1910	CLIP-seq
MIRT1059015	hsa-miR-1972	CLIP-seq
MIRT1059016	hsa-miR-224	CLIP-seq
MIRT1059017	hsa-miR-2278	CLIP-seq
MIRT1059018	hsa-miR-27a	CLIP-seq
MIRT1059019	hsa-miR-27b	CLIP-seq
MIRT1059020	hsa-miR-29a	CLIP-seq
MIRT1059021	hsa-miR-29b	CLIP-seq
MIRT1059022	hsa-miR-29c	CLIP-seq
MIRT1059023	hsa-miR-3127-5p	CLIP-seq
MIRT1059024	hsa-miR-3163	CLIP-seq
MIRT1059025	hsa-miR-340	CLIP-seq
MIRT1059026	hsa-miR-342-5p	CLIP-seq
MIRT1059027	hsa-miR-3667-3p	CLIP-seq
MIRT1059028	hsa-miR-3692	CLIP-seq
MIRT1059029	hsa-miR-3918	CLIP-seq
MIRT1059030	hsa-miR-4259	CLIP-seq
MIRT1059031	hsa-miR-4260	CLIP-seq
MIRT1059032	hsa-miR-4300	CLIP-seq
MIRT1059033	hsa-miR-4306	CLIP-seq
MIRT1059034	hsa-miR-4531	CLIP-seq
MIRT1059035	hsa-miR-4532	CLIP-seq
MIRT1059036	hsa-miR-4644	CLIP-seq
MIRT1059037	hsa-miR-4650-5p	CLIP-seq
MIRT1059038	hsa-miR-4651	CLIP-seq
MIRT1059039	hsa-miR-4664-5p	CLIP-seq
MIRT1059040	hsa-miR-4665-5p	CLIP-seq
MIRT1059041	hsa-miR-4691-3p	CLIP-seq
MIRT1059042	hsa-miR-4709-3p	CLIP-seq
MIRT1059043	hsa-miR-4717-5p	CLIP-seq
MIRT1059044	hsa-miR-4722-5p	CLIP-seq
MIRT1059045	hsa-miR-4768-3p	CLIP-seq
MIRT1059046	hsa-miR-483-3p	CLIP-seq
MIRT1059047	hsa-miR-513a-5p	CLIP-seq
MIRT1059048	hsa-miR-561	CLIP-seq
MIRT1059049	hsa-miR-608	CLIP-seq
MIRT1059050	hsa-miR-615-5p	CLIP-seq
MIRT1059051	hsa-miR-620	CLIP-seq
MIRT1059052	hsa-miR-766	CLIP-seq
MIRT1059053	hsa-miR-769-5p	CLIP-seq
MIRT1059054	hsa-miR-889	CLIP-seq
MIRT1059055	hsa-miR-920	CLIP-seq
MIRT1059027	hsa-miR-3667-3p	CLIP-seq
MIRT1549714	hsa-miR-4632	CLIP-seq
MIRT1059008	hsa-miR-1180	CLIP-seq
MIRT2013769	hsa-miR-1181	CLIP-seq
MIRT2013770	hsa-miR-1207-3p	CLIP-seq
MIRT1059012	hsa-miR-128	CLIP-seq
MIRT2013771	hsa-miR-138	CLIP-seq
MIRT2013772	hsa-miR-149	CLIP-seq
MIRT1059014	hsa-miR-1910	CLIP-seq
MIRT2013773	hsa-miR-1915	CLIP-seq
MIRT1059015	hsa-miR-1972	CLIP-seq
MIRT1059018	hsa-miR-27a	CLIP-seq
MIRT1059019	hsa-miR-27b	CLIP-seq
MIRT1059020	hsa-miR-29a	CLIP-seq
MIRT1059021	hsa-miR-29b	CLIP-seq
MIRT1059022	hsa-miR-29c	CLIP-seq
MIRT2013774	hsa-miR-3064-5p	CLIP-seq
MIRT1059027	hsa-miR-3667-3p	CLIP-seq
MIRT1059030	hsa-miR-4259	CLIP-seq
MIRT1059032	hsa-miR-4300	CLIP-seq
MIRT2013775	hsa-miR-4435	CLIP-seq
MIRT2013776	hsa-miR-4456	CLIP-seq
MIRT2013777	hsa-miR-4514	CLIP-seq
MIRT1059035	hsa-miR-4532	CLIP-seq
MIRT2013778	hsa-miR-4645-5p	CLIP-seq
MIRT1059037	hsa-miR-4650-5p	CLIP-seq
MIRT2013779	hsa-miR-4673	CLIP-seq
MIRT2013780	hsa-miR-4692	CLIP-seq
MIRT1059043	hsa-miR-4717-5p	CLIP-seq
MIRT1059044	hsa-miR-4722-5p	CLIP-seq
MIRT2013781	hsa-miR-4726-3p	CLIP-seq
MIRT1059045	hsa-miR-4768-3p	CLIP-seq
MIRT2013782	hsa-miR-4794	CLIP-seq
MIRT1059047	hsa-miR-513a-5p	CLIP-seq
MIRT1059050	hsa-miR-615-5p	CLIP-seq
MIRT2013783	hsa-miR-760	CLIP-seq
MIRT1059052	hsa-miR-766	CLIP-seq
MIRT1059055	hsa-miR-920	CLIP-seq
MIRT1059023	hsa-miR-3127-5p	CLIP-seq
MIRT2245895	hsa-miR-3194-3p	CLIP-seq
MIRT1059029	hsa-miR-3918	CLIP-seq
MIRT2245896	hsa-miR-4267	CLIP-seq
MIRT1549714	hsa-miR-4632	CLIP-seq
MIRT2245897	hsa-miR-4642	CLIP-seq
MIRT1059008	hsa-miR-1180	CLIP-seq
MIRT2013769	hsa-miR-1181	CLIP-seq
MIRT2013770	hsa-miR-1207-3p	CLIP-seq
MIRT1059012	hsa-miR-128	CLIP-seq
MIRT2437689	hsa-miR-1299	CLIP-seq
MIRT2013771	hsa-miR-138	CLIP-seq
MIRT2013772	hsa-miR-149	CLIP-seq
MIRT1059014	hsa-miR-1910	CLIP-seq
MIRT2013773	hsa-miR-1915	CLIP-seq
MIRT1059015	hsa-miR-1972	CLIP-seq
MIRT1059018	hsa-miR-27a	CLIP-seq
MIRT1059019	hsa-miR-27b	CLIP-seq
MIRT1059020	hsa-miR-29a	CLIP-seq
MIRT1059021	hsa-miR-29b	CLIP-seq
MIRT1059022	hsa-miR-29c	CLIP-seq
MIRT2013774	hsa-miR-3064-5p	CLIP-seq
MIRT2437690	hsa-miR-3065-3p	CLIP-seq
MIRT2437691	hsa-miR-3193	CLIP-seq
MIRT2437692	hsa-miR-3689d	CLIP-seq
MIRT1059030	hsa-miR-4259	CLIP-seq
MIRT1059031	hsa-miR-4260	CLIP-seq
MIRT2013775	hsa-miR-4435	CLIP-seq
MIRT2013776	hsa-miR-4456	CLIP-seq
MIRT2013777	hsa-miR-4514	CLIP-seq
MIRT1059035	hsa-miR-4532	CLIP-seq
MIRT2013778	hsa-miR-4645-5p	CLIP-seq
MIRT1059037	hsa-miR-4650-5p	CLIP-seq
MIRT2013779	hsa-miR-4673	CLIP-seq
MIRT2013780	hsa-miR-4692	CLIP-seq
MIRT1059044	hsa-miR-4722-5p	CLIP-seq
MIRT2013781	hsa-miR-4726-3p	CLIP-seq
MIRT1059045	hsa-miR-4768-3p	CLIP-seq
MIRT2437693	hsa-miR-4782-5p	CLIP-seq
MIRT2013782	hsa-miR-4794	CLIP-seq
MIRT1059047	hsa-miR-513a-5p	CLIP-seq
MIRT2437694	hsa-miR-516b	CLIP-seq
MIRT1059050	hsa-miR-615-5p	CLIP-seq
MIRT2013783	hsa-miR-760	CLIP-seq
MIRT1059052	hsa-miR-766	CLIP-seq
MIRT1059011	hsa-miR-1275	CLIP-seq
MIRT1059026	hsa-miR-342-5p	CLIP-seq
MIRT1059038	hsa-miR-4651	CLIP-seq
MIRT1059039	hsa-miR-4664-5p	CLIP-seq
MIRT1059040	hsa-miR-4665-5p	CLIP-seq
MIRT1059049	hsa-miR-608	CLIP-seq
MIRT2013769	hsa-miR-1181	CLIP-seq
MIRT2013770	hsa-miR-1207-3p	CLIP-seq
MIRT1059009	hsa-miR-1228	CLIP-seq
MIRT1059011	hsa-miR-1275	CLIP-seq
MIRT1059012	hsa-miR-128	CLIP-seq
MIRT2013771	hsa-miR-138	CLIP-seq
MIRT2013772	hsa-miR-149	CLIP-seq
MIRT1059014	hsa-miR-1910	CLIP-seq
MIRT1059015	hsa-miR-1972	CLIP-seq
MIRT1059018	hsa-miR-27a	CLIP-seq
MIRT1059019	hsa-miR-27b	CLIP-seq
MIRT1059020	hsa-miR-29a	CLIP-seq
MIRT1059021	hsa-miR-29b	CLIP-seq
MIRT1059022	hsa-miR-29c	CLIP-seq
MIRT2013774	hsa-miR-3064-5p	CLIP-seq
MIRT1059026	hsa-miR-342-5p	CLIP-seq
MIRT1059032	hsa-miR-4300	CLIP-seq
MIRT2013775	hsa-miR-4435	CLIP-seq
MIRT2013776	hsa-miR-4456	CLIP-seq
MIRT1059037	hsa-miR-4650-5p	CLIP-seq
MIRT1059038	hsa-miR-4651	CLIP-seq
MIRT1059039	hsa-miR-4664-5p	CLIP-seq
MIRT1059040	hsa-miR-4665-5p	CLIP-seq
MIRT1059042	hsa-miR-4709-3p	CLIP-seq
MIRT1059043	hsa-miR-4717-5p	CLIP-seq
MIRT2013782	hsa-miR-4794	CLIP-seq
MIRT1059047	hsa-miR-513a-5p	CLIP-seq
MIRT1059049	hsa-miR-608	CLIP-seq
MIRT2013783	hsa-miR-760	CLIP-seq
MIRT1059052	hsa-miR-766	CLIP-seq
MIRT1059053	hsa-miR-769-5p	CLIP-seq
MIRT1059055	hsa-miR-920	CLIP-seq

Show/Hide all(38)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	TAS	25248477
GO:0001656	Process	Metanephros development	IEA
GO:0003714	Function	Transcription corepressor activity	IBA
GO:0005515	Function	Protein binding	IPI	18255255, 20211142, 20861012, 25416956, 25609649, 28514442, 31515488, 32296183, 32814053, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IC	14627819
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0006275	Process	Regulation of DNA replication	IEA
GO:0007417	Process	Central nervous system development	IEA
GO:0007507	Process	Heart development	IEA
GO:0007517	Process	Muscle organ development	IEA
GO:0007623	Process	Circadian rhythm	IEA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0019904	Function	Protein domain specific binding	IEA
GO:0030182	Process	Neuron differentiation	IBA
GO:0030182	Process	Neuron differentiation	IEA
GO:0030855	Process	Epithelial cell differentiation	IEA
GO:0030903	Process	Notochord development	IEA
GO:0042476	Process	Odontogenesis	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043425	Function	BHLH transcription factor binding	IEA
GO:0043433	Process	Negative regulation of DNA-binding transcription factor activity	IDA	14627819
GO:0045662	Process	Negative regulation of myoblast differentiation	IEA
GO:0045668	Process	Negative regulation of osteoblast differentiation	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	14627819
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0046983	Function	Protein dimerization activity	IEA
GO:0048511	Process	Rhythmic process	IEA
GO:0072750	Process	Cellular response to leptomycin B	IEA
GO:0140416	Function	Transcription regulator inhibitor activity	IEA
GO:0140416	Function	Transcription regulator inhibitor activity	TAS	25248477
GO:1901707	Function	Leptomycin B binding	IEA

MIM	HGNC	e!Ensembl
600277	5362	ENSG00000117318

Protein

UniProt ID

Q02535

Protein name

DNA-binding protein inhibitor ID-3 (Class B basic helix-loop-helix protein 25) (bHLHb25) (Helix-loop-helix protein HEIR-1) (ID-like protein inhibitor HLH 1R21) (Inhibitor of DNA binding 3) (Inhibitor of differentiation 3)

Protein function

Transcriptional regulator (lacking a basic DNA binding domain) which negatively regulates the basic helix-loop-helix (bHLH) transcription factors by forming heterodimers and inhibiting their DNA binding and transcriptional activity. Implicated i

PDB

2LFH

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00010	HLH	40 → 81	Helix-loop-helix DNA-binding domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed abundantly in lung, kidney and adrenal gland, but not in adult brain.

Sequence

MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPR
GTQLSQVEILQRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAELTPELVISNDKRSFCH

Sequence length

119

Interactions

View interactions

	KEGG		Reactome
	TGF-beta signaling pathway Signaling pathways regulating pluripotency of stem cells		NGF-stimulated transcription

ID3 (inhibitor of DNA binding 3)