Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
339829
Gene name Gene Name - the full gene name approved by the HGNC.
Coiled-coil domain 39 molecular ruler complex subunit
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CCDC39
Synonyms (NCBI Gene) Gene synonyms aliases
CFAP59, CILD14, FAP59
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3q26.33
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is involved in the motility of cilia and flagella. The encoded protein is essential for the assembly of dynein regulatory and inner dynein arm complexes, which regulate ciliary beat. Defects in this gene are a cause of pri
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs140505857 G>A Conflicting-interpretations-of-pathogenicity, uncertain-significance Missense variant, coding sequence variant
rs200089274 A>G,T Conflicting-interpretations-of-pathogenicity, likely-benign Intron variant
rs201780665 G>A,T Pathogenic, uncertain-significance Coding sequence variant, synonymous variant, stop gained
rs376782159 G>A,T Conflicting-interpretations-of-pathogenicity Coding sequence variant, stop gained, synonymous variant
rs397515392 C>G Pathogenic Splice donor variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT023078 hsa-miR-124-3p Microarray 18668037
MIRT712571 hsa-miR-4709-5p HITS-CLIP 19536157
MIRT712570 hsa-miR-4742-3p HITS-CLIP 19536157
MIRT712569 hsa-miR-421 HITS-CLIP 19536157
MIRT712568 hsa-miR-335-3p HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001947 Process Heart looping IMP 22693285
GO:0003341 Process Cilium movement IEA
GO:0003341 Process Cilium movement IMP 22499950
GO:0003351 Process Epithelial cilium movement involved in extracellular fluid movement IEA
GO:0003356 Process Regulation of cilium beat frequency IMP 23255504
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
613798 25244 ENSG00000284862
Protein
UniProt ID Q9UFE4
Protein name Coiled-coil domain-containing protein 39
Protein function Required for assembly of dynein regulatory complex (DRC) and inner dynein arm (IDA) complexes, which are responsible for ciliary beat regulation, thereby playing a central role in motility in cilia and flagella (PubMed:21131972). Probably acts t
PDB 8J07
Family and domains
Tissue specificity TISSUE SPECIFICITY: Mainly expressed in nasal brushings and, to a lesser extent, in lungs and testis. {ECO:0000269|PubMed:21131972}.
Sequence
MSSEFLAELHWEDGFAIPVANEENKLLEDQLSKLKDERASLQDELREYEERINSMTSHFK
NVKQELSITQSLCKARERETESEEHFKAIAQRELGRVKDEIQRLENEMASILEKKSDKEN
GIFKATQKLDGLKCQMNWDQQALEAWLEESAHKDSDALTLQKYAQQDDNKIRALTLQLER
LTLECNQKRKILDNELTETISAQLELDKAAQDFRKIHNERQELIKQWENTIEQMQKRDGD
IDNCALELARIKQETREKENLVKEKIKFLESEIGNNTEFEKRISVADRKLLKCRTAYQDH
ETSRIQLKGELDSLKATVNRTSSDLEALRKNISKIKKDIHEETARLQKTKNHNEIIQTKL
KEITEKTMSVEEKATNLEDMLKEEEKDVKEVDVQLNLIKGVLFKKAQELQTETMKEKAVL
SEIEGTRSSLKHLNHQLQKLDFETLKQQEIMYSQDFHIQQVERRMSRLKGEINSEEKQAL
EAKIVELRKSLEEKKSTCGLLETQIKKLHNDLYFIKKAHSKNSDEKQSLMTKINELNLFI
DRSEKELDKAKGFKQDLMIEDNLLKLEVKRTREMLHSKAEEVLSLEKRKQQLYTAMEERT
EEIKVHKTMLASQIRYVDQERENISTEFRERLSKIEKLKNRYEILTVVMLPPEGEEEKTQ
AYYVIKAAQEKEELQREGDCLDAKINKAEKEIYALENTLQVLNSCNNNYKQSFKKVTPSS
DEYELKIQLEEQKRAVDEKYRYKQRQIRELQEDIQSMENTLDVIEHLANNVKEKLSEKQA
YSFQLSKETEEQKPKLERVTKQCAKLTKEIRLLKDTKDETMEEQDIKLREMKQFHKVIDE
MLVDIIEENTEIRIILQTYFQQSGLELPTASTKGSRQSSRSPSHTSLSARSSRSTSTSTS
QSSIKVLELKFPASSSLVGSPSRPSSASSSSSNVKSKKSSK
Sequence length 941
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Ciliary dyskinesia primary ciliary dyskinesia, Primary ciliary dyskinesia 14 rs1560090006, rs863224531, rs757823891, rs1553800956, rs397515392, rs1553805740, rs1560092160, rs756235547, rs771057685, rs1210953680, rs1553804100, rs778577109, rs1007345781, rs587778820, rs1275367324
View all (28 more)
N/A
Heterotaxia Heterotaxy rs1560086701 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Ellis-Van Creveld Syndrome ellis-van creveld syndrome N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Arm Injuries Associate 39383539
Ciliary Motility Disorders Associate 22499950, 23255504, 25186273, 25493340, 30067075, 33479112, 33577779, 35795318, 37660113, 37998386, 38072392, 38154480, 39383539, 39879322
Cleft Lip Associate 28230599
Congenital Abnormalities Associate 23255504, 30067075
Immotile cilia syndrome due to defective radial spokes Associate 23255504
Inflammation Associate 37660113
Kartagener Syndrome Associate 35795318
Lung Diseases Associate 25493340
Lung Injury Associate 30067075
Lung Neoplasms Associate 33896828