Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID	3398
Gene name	Inhibitor of DNA binding 2
Gene symbol	ID2
Synonyms (NCBI Gene)	GIG8ID2AID2HbHLHb26
Chromosome	2
Chromosome location	2p25.1
Summary	The protein encoded by this gene belongs to the inhibitor of DNA binding family, members of which are transcriptional regulators that contain a helix-loop-helix (HLH) domain but not a basic domain. Members of the inhibitor of DNA binding family inhibit th

227

Show/Hide all (227)

miRTarBase ID	miRNA	Experiments	Reference
MIRT007060	hsa-miR-9-5p	ImmunoblotImmunohistochemistryLuciferase reporter assayNorthern blotqRT-PCR	22848373
MIRT007062	hsa-miR-103a-3p	ImmunoblotImmunohistochemistryLuciferase reporter assayNorthern blotqRT-PCR	22848373
MIRT023177	hsa-miR-124-3p	Microarray	18668037
MIRT024314	hsa-miR-215-5p	Microarray	19074876
MIRT026921	hsa-miR-192-5p	Microarray	19074876
MIRT043878	hsa-miR-378a-3p	CLASH	23622248
MIRT354192	hsa-miR-548n	PAR-CLIP	21572407
MIRT354196	hsa-miR-548az-5p	PAR-CLIP	21572407
MIRT354193	hsa-miR-548t-5p	PAR-CLIP	21572407
MIRT255131	hsa-miR-1264	PAR-CLIP	21572407
MIRT207544	hsa-miR-4418	PAR-CLIP	21572407
MIRT207539	hsa-miR-509-3-5p	PAR-CLIP	21572407
MIRT207538	hsa-miR-509-5p	PAR-CLIP	21572407
MIRT207546	hsa-miR-4761-3p	PAR-CLIP	21572407
MIRT207541	hsa-miR-3158-5p	PAR-CLIP	21572407
MIRT207548	hsa-miR-5681a	PAR-CLIP	21572407
MIRT523045	hsa-miR-298	PAR-CLIP	21572407
MIRT354192	hsa-miR-548n	PAR-CLIP	23446348
MIRT354196	hsa-miR-548az-5p	PAR-CLIP	23446348
MIRT354193	hsa-miR-548t-5p	PAR-CLIP	23446348
MIRT523046	hsa-miR-5692a	PAR-CLIP	23446348
MIRT255131	hsa-miR-1264	PAR-CLIP	23446348
MIRT207544	hsa-miR-4418	PAR-CLIP	23446348
MIRT207539	hsa-miR-509-3-5p	PAR-CLIP	23446348
MIRT207538	hsa-miR-509-5p	PAR-CLIP	23446348
MIRT207546	hsa-miR-4761-3p	PAR-CLIP	23446348
MIRT207541	hsa-miR-3158-5p	PAR-CLIP	23446348
MIRT207548	hsa-miR-5681a	PAR-CLIP	23446348
MIRT523045	hsa-miR-298	PAR-CLIP	23446348
MIRT523044	hsa-miR-335-3p	PAR-CLIP	23446348
MIRT496532	hsa-miR-6768-5p	PAR-CLIP	22291592
MIRT496531	hsa-miR-1179	PAR-CLIP	22291592
MIRT496530	hsa-miR-4310	PAR-CLIP	22291592
MIRT496529	hsa-miR-7157-5p	PAR-CLIP	22291592
MIRT496528	hsa-miR-936	PAR-CLIP	22291592
MIRT496527	hsa-miR-199a-3p	PAR-CLIP	22291592
MIRT496526	hsa-miR-199b-3p	PAR-CLIP	22291592
MIRT496525	hsa-miR-3129-5p	PAR-CLIP	22291592
MIRT496524	hsa-miR-581	PAR-CLIP	22291592
MIRT496523	hsa-miR-4672	PAR-CLIP	22291592
MIRT496522	hsa-miR-4789-5p	PAR-CLIP	22291592
MIRT496521	hsa-miR-222-5p	PAR-CLIP	22291592
MIRT736294	hsa-miR-210-3p	RNA-seqFlow cytometry	32099460
MIRT354192	hsa-miR-548n	PAR-CLIP	21572407
MIRT354196	hsa-miR-548az-5p	PAR-CLIP	21572407
MIRT354193	hsa-miR-548t-5p	PAR-CLIP	21572407
MIRT255131	hsa-miR-1264	PAR-CLIP	21572407
MIRT207544	hsa-miR-4418	PAR-CLIP	21572407
MIRT207539	hsa-miR-509-3-5p	PAR-CLIP	21572407
MIRT207538	hsa-miR-509-5p	PAR-CLIP	21572407
MIRT207546	hsa-miR-4761-3p	PAR-CLIP	21572407
MIRT207541	hsa-miR-3158-5p	PAR-CLIP	21572407
MIRT207548	hsa-miR-5681a	PAR-CLIP	21572407
MIRT523045	hsa-miR-298	PAR-CLIP	21572407
MIRT354192	hsa-miR-548n	PAR-CLIP	23446348
MIRT354196	hsa-miR-548az-5p	PAR-CLIP	23446348
MIRT354193	hsa-miR-548t-5p	PAR-CLIP	23446348
MIRT523046	hsa-miR-5692a	PAR-CLIP	23446348
MIRT255131	hsa-miR-1264	PAR-CLIP	23446348
MIRT207544	hsa-miR-4418	PAR-CLIP	23446348
MIRT207539	hsa-miR-509-3-5p	PAR-CLIP	23446348
MIRT207538	hsa-miR-509-5p	PAR-CLIP	23446348
MIRT207546	hsa-miR-4761-3p	PAR-CLIP	23446348
MIRT207541	hsa-miR-3158-5p	PAR-CLIP	23446348
MIRT207548	hsa-miR-5681a	PAR-CLIP	23446348
MIRT523045	hsa-miR-298	PAR-CLIP	23446348
MIRT523044	hsa-miR-335-3p	PAR-CLIP	23446348
MIRT496532	hsa-miR-6768-5p	PAR-CLIP	22291592
MIRT496531	hsa-miR-1179	PAR-CLIP	22291592
MIRT496530	hsa-miR-4310	PAR-CLIP	22291592
MIRT496529	hsa-miR-7157-5p	PAR-CLIP	22291592
MIRT496528	hsa-miR-936	PAR-CLIP	22291592
MIRT496527	hsa-miR-199a-3p	PAR-CLIP	22291592
MIRT496526	hsa-miR-199b-3p	PAR-CLIP	22291592
MIRT496525	hsa-miR-3129-5p	PAR-CLIP	22291592
MIRT496524	hsa-miR-581	PAR-CLIP	22291592
MIRT496523	hsa-miR-4672	PAR-CLIP	22291592
MIRT496522	hsa-miR-4789-5p	PAR-CLIP	22291592
MIRT496521	hsa-miR-222-5p	PAR-CLIP	22291592
MIRT1058967	hsa-miR-1237	CLIP-seq
MIRT1058968	hsa-miR-1243	CLIP-seq
MIRT1058969	hsa-miR-1248	CLIP-seq
MIRT1058970	hsa-miR-200b	CLIP-seq
MIRT1058971	hsa-miR-200c	CLIP-seq
MIRT1058972	hsa-miR-203	CLIP-seq
MIRT1058973	hsa-miR-2355-3p	CLIP-seq
MIRT1058974	hsa-miR-3065-3p	CLIP-seq
MIRT1058975	hsa-miR-3121-3p	CLIP-seq
MIRT1058976	hsa-miR-3136-5p	CLIP-seq
MIRT1058977	hsa-miR-3545-3p	CLIP-seq
MIRT1058978	hsa-miR-3611	CLIP-seq
MIRT1058979	hsa-miR-3618	CLIP-seq
MIRT1058980	hsa-miR-3620	CLIP-seq
MIRT1058981	hsa-miR-3654	CLIP-seq
MIRT1058982	hsa-miR-3909	CLIP-seq
MIRT1058983	hsa-miR-3940-5p	CLIP-seq
MIRT1058984	hsa-miR-429	CLIP-seq
MIRT1058985	hsa-miR-4291	CLIP-seq
MIRT1058986	hsa-miR-4292	CLIP-seq
MIRT1058987	hsa-miR-4427	CLIP-seq
MIRT1058988	hsa-miR-4439	CLIP-seq
MIRT1058989	hsa-miR-4490	CLIP-seq
MIRT1058990	hsa-miR-4507	CLIP-seq
MIRT1058991	hsa-miR-4513	CLIP-seq
MIRT1058992	hsa-miR-4646-5p	CLIP-seq
MIRT1058993	hsa-miR-4727-5p	CLIP-seq
MIRT1058994	hsa-miR-4747-5p	CLIP-seq
MIRT1058995	hsa-miR-4760-5p	CLIP-seq
MIRT1058996	hsa-miR-4769-3p	CLIP-seq
MIRT1058997	hsa-miR-4774-5p	CLIP-seq
MIRT1058998	hsa-miR-502-5p	CLIP-seq
MIRT1058999	hsa-miR-513a-3p	CLIP-seq
MIRT1059000	hsa-miR-522	CLIP-seq
MIRT1059001	hsa-miR-541	CLIP-seq
MIRT1059002	hsa-miR-548an	CLIP-seq
MIRT1059003	hsa-miR-563	CLIP-seq
MIRT1059004	hsa-miR-643	CLIP-seq
MIRT1059005	hsa-miR-654-5p	CLIP-seq
MIRT1059006	hsa-miR-676	CLIP-seq
MIRT1059007	hsa-miR-935	CLIP-seq
MIRT1058967	hsa-miR-1237	CLIP-seq
MIRT1058968	hsa-miR-1243	CLIP-seq
MIRT1058969	hsa-miR-1248	CLIP-seq
MIRT2245865	hsa-miR-128	CLIP-seq
MIRT2245866	hsa-miR-134	CLIP-seq
MIRT2245867	hsa-miR-142-5p	CLIP-seq
MIRT2245868	hsa-miR-186	CLIP-seq
MIRT1058970	hsa-miR-200b	CLIP-seq
MIRT1058971	hsa-miR-200c	CLIP-seq
MIRT2245869	hsa-miR-27a	CLIP-seq
MIRT2245870	hsa-miR-27b	CLIP-seq
MIRT1058974	hsa-miR-3065-3p	CLIP-seq
MIRT2245871	hsa-miR-3118	CLIP-seq
MIRT1058975	hsa-miR-3121-3p	CLIP-seq
MIRT2245872	hsa-miR-3133	CLIP-seq
MIRT1058976	hsa-miR-3136-5p	CLIP-seq
MIRT2245873	hsa-miR-330-3p	CLIP-seq
MIRT2245874	hsa-miR-340	CLIP-seq
MIRT1058977	hsa-miR-3545-3p	CLIP-seq
MIRT1058979	hsa-miR-3618	CLIP-seq
MIRT1058980	hsa-miR-3620	CLIP-seq
MIRT1058981	hsa-miR-3654	CLIP-seq
MIRT2245875	hsa-miR-3691-3p	CLIP-seq
MIRT2245876	hsa-miR-374a	CLIP-seq
MIRT2245877	hsa-miR-374b	CLIP-seq
MIRT1058982	hsa-miR-3909	CLIP-seq
MIRT2245878	hsa-miR-3925-5p	CLIP-seq
MIRT2245879	hsa-miR-410	CLIP-seq
MIRT1058984	hsa-miR-429	CLIP-seq
MIRT1058985	hsa-miR-4291	CLIP-seq
MIRT1058986	hsa-miR-4292	CLIP-seq
MIRT2245880	hsa-miR-4422	CLIP-seq
MIRT1058987	hsa-miR-4427	CLIP-seq
MIRT1058988	hsa-miR-4439	CLIP-seq
MIRT1058989	hsa-miR-4490	CLIP-seq
MIRT1058991	hsa-miR-4513	CLIP-seq
MIRT2245881	hsa-miR-455-3p	CLIP-seq
MIRT1058992	hsa-miR-4646-5p	CLIP-seq
MIRT2245882	hsa-miR-4690-5p	CLIP-seq
MIRT2245883	hsa-miR-4705	CLIP-seq
MIRT2245884	hsa-miR-4729	CLIP-seq
MIRT2245885	hsa-miR-4742-5p	CLIP-seq
MIRT1058994	hsa-miR-4747-5p	CLIP-seq
MIRT2245886	hsa-miR-4766-5p	CLIP-seq
MIRT1058997	hsa-miR-4774-5p	CLIP-seq
MIRT2245887	hsa-miR-499-3p	CLIP-seq
MIRT2245888	hsa-miR-499a-3p	CLIP-seq
MIRT1058998	hsa-miR-502-5p	CLIP-seq
MIRT1058999	hsa-miR-513a-3p	CLIP-seq
MIRT1059001	hsa-miR-541	CLIP-seq
MIRT2245889	hsa-miR-548t	CLIP-seq
MIRT2245890	hsa-miR-548u	CLIP-seq
MIRT2245891	hsa-miR-579	CLIP-seq
MIRT2245892	hsa-miR-592	CLIP-seq
MIRT2245893	hsa-miR-597	CLIP-seq
MIRT2245894	hsa-miR-599	CLIP-seq
MIRT1059004	hsa-miR-643	CLIP-seq
MIRT1059005	hsa-miR-654-5p	CLIP-seq
MIRT1058967	hsa-miR-1237	CLIP-seq
MIRT1058968	hsa-miR-1243	CLIP-seq
MIRT1058969	hsa-miR-1248	CLIP-seq
MIRT1058970	hsa-miR-200b	CLIP-seq
MIRT1058971	hsa-miR-200c	CLIP-seq
MIRT1058981	hsa-miR-3654	CLIP-seq
MIRT1058984	hsa-miR-429	CLIP-seq
MIRT1058989	hsa-miR-4490	CLIP-seq
MIRT1058995	hsa-miR-4760-5p	CLIP-seq
MIRT1058997	hsa-miR-4774-5p	CLIP-seq
MIRT1058998	hsa-miR-502-5p	CLIP-seq
MIRT1059001	hsa-miR-541	CLIP-seq
MIRT1059002	hsa-miR-548an	CLIP-seq
MIRT1059005	hsa-miR-654-5p	CLIP-seq
MIRT1058967	hsa-miR-1237	CLIP-seq
MIRT1058968	hsa-miR-1243	CLIP-seq
MIRT1058969	hsa-miR-1248	CLIP-seq
MIRT2682553	hsa-miR-1276	CLIP-seq
MIRT2682554	hsa-miR-1284	CLIP-seq
MIRT2245867	hsa-miR-142-5p	CLIP-seq
MIRT2245868	hsa-miR-186	CLIP-seq
MIRT1058970	hsa-miR-200b	CLIP-seq
MIRT1058971	hsa-miR-200c	CLIP-seq
MIRT2682555	hsa-miR-300	CLIP-seq
MIRT1058975	hsa-miR-3121-3p	CLIP-seq
MIRT2245872	hsa-miR-3133	CLIP-seq
MIRT2245874	hsa-miR-340	CLIP-seq
MIRT1058981	hsa-miR-3654	CLIP-seq
MIRT2682556	hsa-miR-3671	CLIP-seq
MIRT2682557	hsa-miR-381	CLIP-seq
MIRT2245879	hsa-miR-410	CLIP-seq
MIRT2682558	hsa-miR-4252	CLIP-seq
MIRT1058984	hsa-miR-429	CLIP-seq
MIRT2682559	hsa-miR-4311	CLIP-seq
MIRT2682560	hsa-miR-4457	CLIP-seq
MIRT1058989	hsa-miR-4490	CLIP-seq
MIRT2682561	hsa-miR-4666-3p	CLIP-seq
MIRT2682562	hsa-miR-4735-5p	CLIP-seq
MIRT1058995	hsa-miR-4760-5p	CLIP-seq
MIRT1058997	hsa-miR-4774-5p	CLIP-seq
MIRT1058998	hsa-miR-502-5p	CLIP-seq
MIRT2682563	hsa-miR-513b	CLIP-seq
MIRT1059001	hsa-miR-541	CLIP-seq
MIRT1059002	hsa-miR-548an	CLIP-seq
MIRT2682564	hsa-miR-583	CLIP-seq
MIRT2682565	hsa-miR-618	CLIP-seq
MIRT2682566	hsa-miR-624	CLIP-seq
MIRT1059005	hsa-miR-654-5p	CLIP-seq
MIRT2682567	hsa-miR-888	CLIP-seq

Show/Hide all (11)

Transcription factor	Regulation	Reference
FLI1	Activation	12447693
HOXA10	Activation	20565746
HOXA9	Activation	20565746
MYC	Unknown	12545167
MYCN	Unknown	12670915
POU2AF1	Unknown	24801987
POU2F2	Unknown	24801987
POU5F1	Repression	17068183
TP53	Unknown	16557594
TP63	Repression	21478550
ZBTB16	Unknown	19723763

117

Show/Hide all (117)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	ISS
GO:0000791	Component	Euchromatin	IEA
GO:0000791	Component	Euchromatin	ISS
GO:0001656	Process	Metanephros development	IEA
GO:0001779	Process	Natural killer cell differentiation	IEA
GO:0001966	Process	Thigmotaxis	IEA
GO:0002521	Process	Leukocyte differentiation	IEA
GO:0003149	Process	Membranous septum morphogenesis	IEA
GO:0003166	Process	Bundle of His development	IEA
GO:0003166	Process	Bundle of His development	ISS
GO:0003714	Function	Transcription corepressor activity	IBA
GO:0005515	Function	Protein binding	IPI	10915743, 14752053, 16311606, 16549780, 19321746, 20861012, 22453338, 25609649, 28514442, 32296183, 32814053, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IC	14627819
GO:0005634	Component	Nucleus	IDA	16311606
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	16311606
GO:0005737	Component	Cytoplasm	IDA	20861012
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	16311606
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IMP	16311606
GO:0007507	Process	Heart development	IEA
GO:0007507	Process	Heart development	ISS
GO:0007623	Process	Circadian rhythm	IEA
GO:0007623	Process	Circadian rhythm	ISS
GO:0008344	Process	Adult locomotory behavior	IEA
GO:0009649	Process	Entrainment of circadian clock	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	ISS
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0010629	Process	Negative regulation of gene expression	ISS
GO:0014003	Process	Oligodendrocyte development	IEA
GO:0019216	Process	Regulation of lipid metabolic process	IEA
GO:0019216	Process	Regulation of lipid metabolic process	ISS
GO:0021772	Process	Olfactory bulb development	IEA
GO:0021772	Process	Olfactory bulb development	ISS
GO:0030182	Process	Neuron differentiation	IBA
GO:0030183	Process	B cell differentiation	IEA
GO:0030218	Process	Erythrocyte differentiation	IEA
GO:0032922	Process	Circadian regulation of gene expression	IEA
GO:0032922	Process	Circadian regulation of gene expression	ISS
GO:0032991	Component	Protein-containing complex	IEA
GO:0032991	Component	Protein-containing complex	ISS
GO:0033598	Process	Mammary gland epithelial cell proliferation	IEA
GO:0033598	Process	Mammary gland epithelial cell proliferation	ISS
GO:0042752	Process	Regulation of circadian rhythm	IEA
GO:0042752	Process	Regulation of circadian rhythm	ISS
GO:0043153	Process	Entrainment of circadian clock by photoperiod	IEA
GO:0043153	Process	Entrainment of circadian clock by photoperiod	ISS
GO:0043353	Process	Enucleate erythrocyte differentiation	IEA
GO:0043353	Process	Enucleate erythrocyte differentiation	ISS
GO:0043433	Process	Negative regulation of DNA-binding transcription factor activity	IDA	14627819
GO:0044325	Function	Transmembrane transporter binding	IPI	16311606
GO:0045475	Process	Locomotor rhythm	IEA
GO:0045475	Process	Locomotor rhythm	ISS
GO:0045578	Process	Negative regulation of B cell differentiation	IEA
GO:0045578	Process	Negative regulation of B cell differentiation	ISS
GO:0045600	Process	Positive regulation of fat cell differentiation	IEA
GO:0045600	Process	Positive regulation of fat cell differentiation	ISS
GO:0045648	Process	Positive regulation of erythrocyte differentiation	IEA
GO:0045651	Process	Positive regulation of macrophage differentiation	IEA
GO:0045651	Process	Positive regulation of macrophage differentiation	ISS
GO:0045664	Process	Regulation of neuron differentiation	IEA
GO:0045664	Process	Regulation of neuron differentiation	ISS
GO:0045668	Process	Negative regulation of osteoblast differentiation	IEA
GO:0045777	Process	Positive regulation of blood pressure	IEA
GO:0045777	Process	Positive regulation of blood pressure	ISS
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	14627819
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	ISS
GO:0046983	Function	Protein dimerization activity	IEA
GO:0048468	Process	Cell development	IEA
GO:0048469	Process	Cell maturation	IEA
GO:0048511	Process	Rhythmic process	IEA
GO:0048541	Process	Peyer's patch development	IEA
GO:0048557	Process	Embryonic digestive tract morphogenesis	IEA
GO:0048557	Process	Embryonic digestive tract morphogenesis	ISS
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	IEA
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	ISS
GO:0048663	Process	Neuron fate commitment	IEA
GO:0048663	Process	Neuron fate commitment	ISS
GO:0048667	Process	Cell morphogenesis involved in neuron differentiation	IEA
GO:0048708	Process	Astrocyte differentiation	IEA
GO:0048709	Process	Oligodendrocyte differentiation	IEA
GO:0048711	Process	Positive regulation of astrocyte differentiation	IEA
GO:0048711	Process	Positive regulation of astrocyte differentiation	ISS
GO:0048715	Process	Negative regulation of oligodendrocyte differentiation	IEA
GO:0050872	Process	White fat cell differentiation	IEA
GO:0051148	Process	Negative regulation of muscle cell differentiation	IEA
GO:0051148	Process	Negative regulation of muscle cell differentiation	ISS
GO:0060612	Process	Adipose tissue development	IEA
GO:0060749	Process	Mammary gland alveolus development	IEA
GO:0060749	Process	Mammary gland alveolus development	ISS
GO:0061030	Process	Epithelial cell differentiation involved in mammary gland alveolus development	IEA
GO:0061030	Process	Epithelial cell differentiation involved in mammary gland alveolus development	ISS
GO:0061031	Process	Endodermal digestive tract morphogenesis	IEA
GO:0061031	Process	Endodermal digestive tract morphogenesis	ISS
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IEA
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	ISS
GO:0071285	Process	Cellular response to lithium ion	IEA
GO:0071542	Process	Dopaminergic neuron differentiation	IEA
GO:0090398	Process	Cellular senescence	IEA
GO:0090398	Process	Cellular senescence	ISS
GO:0140416	Function	Transcription regulator inhibitor activity	IEA
GO:0140416	Function	Transcription regulator inhibitor activity	ISS
GO:0140416	Function	Transcription regulator inhibitor activity	TAS	25248477
GO:1904339	Process	Negative regulation of dopaminergic neuron differentiation	IEA
GO:2000045	Process	Regulation of G1/S transition of mitotic cell cycle	IMP	16311606
GO:2000177	Process	Regulation of neural precursor cell proliferation	IEA
GO:2000177	Process	Regulation of neural precursor cell proliferation	ISS

MIM	HGNC	e!Ensembl
600386	5361	ENSG00000115738

Q02363

Protein name

DNA-binding protein inhibitor ID-2 (Class B basic helix-loop-helix protein 26) (bHLHb26) (Inhibitor of DNA binding 2) (Inhibitor of differentiation 2)

Protein function

Transcriptional regulator (lacking a basic DNA binding domain) which negatively regulates the basic helix-loop-helix (bHLH) transcription factors by forming heterodimers and inhibiting their DNA binding and transcriptional activity. Implicated i

PDB

4AYA

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00010	HLH	35 → 76	Helix-loop-helix DNA-binding domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in early fetal tissues, including those of the central nervous system.

Sequence

MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVS
KMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEF
PSELMSNDSKALCG

Sequence length

134

Interactions

View interactions

	KEGG		Reactome
	TGF-beta signaling pathway Hippo signaling pathway Signaling pathways regulating pluripotency of stem cells Transcriptional misregulation in cancer		NGF-stimulated transcription

ID2 (inhibitor of DNA binding 2)