LINC00299 (long intergenic non-protein coding RNA 299)

Gene
Gene Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
339789
Gene name Gene Name - the full gene name approved by the HGNC.
Long intergenic non-protein coding RNA 299
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
LINC00299
Synonyms (NCBI Gene) Gene synonyms aliases
C2orf46, LINC00298, LINC01814, NCRNA00299
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2p25.1
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein
Gene Other IDs Protein Associated diseases
UniProt ID Q6ZSB3
Protein name Putative uncharacterized protein encoded by LINC00299
Family and domains
Sequence 
MVQREKARDNFEGGCLAELIGSPRDWKCFLAVPDPLLGVQHWLHLWRPQTKDGNSLHRHG
DQAWGKHRRQNSLKSPALSGHSIDYHFYPRLRCGMLIGPDKQAVASGLEVLVTSSTKILG
QLFPDAAHFLEEASEFKAE
Sequence length 139
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (12)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Allergic Sensitization Allergic sensitization N/A N/A GWAS
Asthma Asthma (age of onset), Pediatric asthma, Asthma, Asthma (childhood onset), Age of onset of adult onset asthma, Nonatopic asthma, Age of onset of childhood onset asthma, Atopic asthma, Asthma in any disease N/A N/A GWAS
Biliary Cholangitis Primary biliary cholangitis N/A N/A GWAS
Dermatitis Atopic dermatitis N/A N/A GWAS
Show/Hide Text Mining Associations (6)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 32650023
Asthma Associate 32650023
Disease Associate 24625750
Neoplasm Metastasis Associate 30320389
Neoplasms Associate 30320389
Triple Negative Breast Neoplasms Associate 32678138