Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3397
Gene name Gene Name - the full gene name approved by the HGNC.	Inhibitor of DNA binding 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ID1
Synonyms (NCBI Gene) Gene synonyms aliases	ID, bHLHb24
Chromosome Chromosome number	20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	20q11.21
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a helix-loop-helix (HLH) protein that can form heterodimers with members of the basic HLH family of transcription factors. The encoded protein has no DNA binding activity and therefore can inhibit the DNA binding and tr

Show/Hide all(88)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003418	hsa-miR-100-5p	Microarray, qRT-PCR	19396866
MIRT004739	hsa-miR-520h	Microarray, qRT-PCR	19435428
MIRT022546	hsa-miR-124-3p	Microarray	18668037
MIRT024947	hsa-miR-215-5p	Microarray	19074876
MIRT026397	hsa-miR-192-5p	Microarray	19074876
MIRT029333	hsa-miR-26b-5p	Microarray	19088304
MIRT052982	hsa-miR-381-3p	Luciferase reporter assay, qRT-PCR, Western blot	22592211
MIRT052982	hsa-miR-381-3p	HITS-CLIP	24374217
MIRT439157	hsa-let-7c-5p	3'LIFE	25074381
MIRT052982	hsa-miR-381-3p	HITS-CLIP	24374217
MIRT439157	hsa-let-7c-5p	3'LIFE	25074381
MIRT736667	hsa-miR-338-5p	Luciferase reporter assay, Western blotting, qRT-PCR	31646712
MIRT1058947	hsa-miR-1238	CLIP-seq
MIRT1058948	hsa-miR-1253	CLIP-seq
MIRT1058949	hsa-miR-2054	CLIP-seq
MIRT1058950	hsa-miR-29a	CLIP-seq
MIRT1058951	hsa-miR-29b	CLIP-seq
MIRT1058952	hsa-miR-29c	CLIP-seq
MIRT1058953	hsa-miR-300	CLIP-seq
MIRT1058954	hsa-miR-3200-5p	CLIP-seq
MIRT1058955	hsa-miR-330-3p	CLIP-seq
MIRT736667	hsa-miR-338-5p	CLIP-seq
MIRT1058956	hsa-miR-381	CLIP-seq
MIRT1058957	hsa-miR-4251	CLIP-seq
MIRT1058958	hsa-miR-4289	CLIP-seq
MIRT1058959	hsa-miR-4329	CLIP-seq
MIRT1058960	hsa-miR-4666-3p	CLIP-seq
MIRT1058961	hsa-miR-520d-5p	CLIP-seq
MIRT1058962	hsa-miR-524-5p	CLIP-seq
MIRT1058963	hsa-miR-591	CLIP-seq
MIRT1058964	hsa-miR-2355-5p	CLIP-seq
MIRT1058965	hsa-miR-3127-3p	CLIP-seq
MIRT1058966	hsa-miR-4313	CLIP-seq
MIRT2245849	hsa-miR-1275	CLIP-seq
MIRT2245850	hsa-miR-2117	CLIP-seq
MIRT2245851	hsa-miR-3175	CLIP-seq
MIRT2245852	hsa-miR-3197	CLIP-seq
MIRT2245853	hsa-miR-4273	CLIP-seq
MIRT2245854	hsa-miR-4285	CLIP-seq
MIRT2245855	hsa-miR-4287	CLIP-seq
MIRT2245856	hsa-miR-4330	CLIP-seq
MIRT2245857	hsa-miR-4469	CLIP-seq
MIRT2245858	hsa-miR-4525	CLIP-seq
MIRT2245859	hsa-miR-4665-5p	CLIP-seq
MIRT2245860	hsa-miR-4677-5p	CLIP-seq
MIRT2245861	hsa-miR-4685-3p	CLIP-seq
MIRT2245862	hsa-miR-4713-5p	CLIP-seq
MIRT2245863	hsa-miR-4723-5p	CLIP-seq
MIRT2245864	hsa-miR-625	CLIP-seq
MIRT1058947	hsa-miR-1238	CLIP-seq
MIRT1058948	hsa-miR-1253	CLIP-seq
MIRT2245849	hsa-miR-1275	CLIP-seq
MIRT2437683	hsa-miR-1287	CLIP-seq
MIRT2245850	hsa-miR-2117	CLIP-seq
MIRT1058950	hsa-miR-29a	CLIP-seq
MIRT1058951	hsa-miR-29b	CLIP-seq
MIRT1058952	hsa-miR-29c	CLIP-seq
MIRT2245851	hsa-miR-3175	CLIP-seq
MIRT2245852	hsa-miR-3197	CLIP-seq
MIRT1058954	hsa-miR-3200-5p	CLIP-seq
MIRT1058955	hsa-miR-330-3p	CLIP-seq
MIRT2437684	hsa-miR-3652	CLIP-seq
MIRT2437685	hsa-miR-3677-5p	CLIP-seq
MIRT1058957	hsa-miR-4251	CLIP-seq
MIRT2245853	hsa-miR-4273	CLIP-seq
MIRT2245854	hsa-miR-4285	CLIP-seq
MIRT2245855	hsa-miR-4287	CLIP-seq
MIRT2437686	hsa-miR-4323	CLIP-seq
MIRT1058959	hsa-miR-4329	CLIP-seq
MIRT2245856	hsa-miR-4330	CLIP-seq
MIRT2437687	hsa-miR-4430	CLIP-seq
MIRT2245857	hsa-miR-4469	CLIP-seq
MIRT2245858	hsa-miR-4525	CLIP-seq
MIRT2245859	hsa-miR-4665-5p	CLIP-seq
MIRT2245860	hsa-miR-4677-5p	CLIP-seq
MIRT2245861	hsa-miR-4685-3p	CLIP-seq
MIRT2437688	hsa-miR-4690-3p	CLIP-seq
MIRT2245862	hsa-miR-4713-5p	CLIP-seq
MIRT2245863	hsa-miR-4723-5p	CLIP-seq
MIRT1058961	hsa-miR-520d-5p	CLIP-seq
MIRT1058962	hsa-miR-524-5p	CLIP-seq
MIRT1058963	hsa-miR-591	CLIP-seq
MIRT2245864	hsa-miR-625	CLIP-seq
MIRT2451577	hsa-miR-1825	CLIP-seq
MIRT2451578	hsa-miR-4279	CLIP-seq
MIRT2437688	hsa-miR-4690-3p	CLIP-seq
MIRT2451579	hsa-miR-515-3p	CLIP-seq
MIRT2451580	hsa-miR-519e	CLIP-seq

Transcription factors

Show/Hide all(8)

Transcription factor	Regulation	Reference
ATF3	Repression	20565867
ATF5	Repression	18701499
CEBPA	Unknown	22568493
POU2F1	Unknown	19212692
TP53	Unknown	16557594
TRIM28	Unknown	21876767
WHSC1	Unknown	16115125
ZNF382	Repression	20682794

Show/Hide all(42)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA	21873635
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	7665172
GO:0001525	Process	Angiogenesis	TAS	14522471
GO:0005515	Function	Protein binding	IPI	15694377, 17855368, 20861012, 21988832, 25609649, 32296183, 32814053
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005794	Component	Golgi apparatus	IDA
GO:0005813	Component	Centrosome	IEA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	TAS	14522471
GO:0007420	Process	Brain development	IEA
GO:0008022	Function	Protein C-terminus binding	IEA
GO:0008134	Function	Transcription factor binding	IEA
GO:0010621	Process	Negative regulation of transcription by transcription factor localization	TAS	14522471
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0030154	Process	Cell differentiation	IBA	21873635
GO:0030182	Process	Neuron differentiation	IEA
GO:0032091	Process	Negative regulation of protein binding	IEA
GO:0032233	Process	Positive regulation of actin filament bundle assembly	IEA
GO:0032922	Process	Circadian regulation of gene expression	IBA	21873635
GO:0036164	Process	Cell-abiotic substrate adhesion	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043392	Process	Negative regulation of DNA binding	IEA
GO:0043433	Process	Negative regulation of DNA-binding transcription factor activity	IDA	7665172
GO:0043534	Process	Blood vessel endothelial cell migration	TAS	14522471
GO:0045602	Process	Negative regulation of endothelial cell differentiation	IEA
GO:0045892	Process	Negative regulation of transcription, DNA-templated	IDA	15138269
GO:0046983	Function	Protein dimerization activity	IEA
GO:0047485	Function	Protein N-terminus binding	IEA
GO:0048514	Process	Blood vessel morphogenesis	TAS	14522471
GO:0050679	Process	Positive regulation of epithelial cell proliferation	IEA
GO:0050774	Process	Negative regulation of dendrite morphogenesis	IEA
GO:0070628	Function	Proteasome binding	IEA
GO:0071364	Process	Cellular response to epidermal growth factor stimulus	IEA
GO:0120163	Process	Negative regulation of cold-induced thermogenesis	ISS	28270523
GO:0140110	Function	Transcription regulator activity	IBA	21873635
GO:0140416	Function	Transcription regulator inhibitor activity	IDA	7665172
GO:1901342	Process	Regulation of vasculature development	IEA
GO:1901653	Process	Cellular response to peptide	IEA
GO:1903351	Process	Cellular response to dopamine	IEA
GO:1990090	Process	Cellular response to nerve growth factor stimulus	IEA

MIM	HGNC	e!Ensembl
600349	5360	ENSG00000125968

Protein

UniProt ID

P41134

Protein name

DNA-binding protein inhibitor ID-1 (Class B basic helix-loop-helix protein 24) (bHLHb24) (Inhibitor of DNA binding 1) (Inhibitor of differentiation 1)

Protein function

Transcriptional regulator (lacking a basic DNA binding domain) which negatively regulates the basic helix-loop-helix (bHLH) transcription factors by forming heterodimers and inhibiting their DNA binding and transcriptional activity. Implicated i

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00010	HLH	66 → 106	Helix-loop-helix DNA-binding domain	Domain

Sequence

MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQ
QVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGG
RGLPVRAPLSTLNGEISALTAEAACVPADDRILCR

Sequence length

155

Interactions

View interactions

	KEGG		Reactome
	Rap1 signaling pathway TGF-beta signaling pathway Hippo signaling pathway Signaling pathways regulating pluripotency of stem cells		Oncogene Induced Senescence NGF-stimulated transcription

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Diabetes mellitus	Diabetes Mellitus, Non-Insulin-Dependent	rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs1362648752, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237 View all (293 more)	16123366

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Metabolic Syndrome	Metabolic Syndrome			GWAS

Show/Hide Text Mining Associations (88)

Disease Name	Relationship Type	References
Associations from Text Mining
Abnormalities Drug Induced	Associate	20070914
Adenocarcinoma	Associate	39334961
Adenocarcinoma of Lung	Associate	22592211, 26869608
Adenomyosis	Associate	38195505
Arthritis Rheumatoid	Associate	30861322
Atherosclerosis	Associate	34052320
Biliary Tract Neoplasms	Associate	24409060
Breast Neoplasms	Associate	18648363, 19419954, 21955753, 24504364, 24948111, 25242400, 32661241
Breast Neoplasms	Inhibit	30066902
Calcinosis Cutis	Associate	19491902
Carcinogenesis	Associate	12719589, 15999366, 18556654, 19447105, 20574154, 21670698, 23342268, 26858249
Carcinoma Adenoid Cystic	Associate	29039489
Carcinoma Hepatocellular	Stimulate	15999366
Carcinoma Hepatocellular	Associate	19567783, 20574154, 22819717, 33834612, 36513250, 37085918, 37446238, 37964494, 37978846
Carcinoma Lobular	Associate	32661241
Carcinoma Non Small Cell Lung	Associate	24133588, 25028095, 25344919, 29233161, 32275644, 33992097
Carcinoma Renal Cell	Associate	33178820
Cerebral Infarction	Associate	36582228
Cholesteatoma	Associate	18347258
Cholesteatoma Middle Ear	Associate	18347258, 20887552
Colonic Neoplasms	Associate	18513385, 30887652, 30994840
Colorectal Neoplasms	Associate	19014499, 19798702, 21554132, 28510612, 28767654, 34841646, 37996458
Death	Stimulate	26869608
Drug Related Side Effects and Adverse Reactions	Associate	20388787
Drug Related Side Effects and Adverse Reactions	Inhibit	30584986
Endometriosis	Associate	25207642, 26577912, 36232817
Epstein Barr Virus Infections	Associate	21701587
Esophageal Neoplasms	Associate	18000500, 21896993, 26858249
Esophageal Squamous Cell Carcinoma	Stimulate	18000500
Esophageal Squamous Cell Carcinoma	Associate	21896993, 26858249, 37607071
Fibrosis	Associate	15999366, 25132585
Gallbladder Neoplasms	Associate	28611292
Glioblastoma	Associate	28767654, 39938577
Glioma	Associate	27065332
Hemangioma	Associate	30584986
Hereditary Breast and Ovarian Cancer Syndrome	Associate	18648363
Homozygous Familial Hypercholesterolemia	Associate	34052320
Hypertension Pulmonary	Associate	16840720
Hypoxia	Inhibit	16840720
Hypoxia Brain	Stimulate	23029547
Infections	Stimulate	28794048
Inflammation	Associate	36582228
Leukemia	Associate	19643984, 35806401, 37032592
Leukemia Biphenotypic Acute	Associate	33390793, 39676870
Leukemia Myeloid Acute	Associate	19643984, 26191235, 27784745
Leukemia Myeloid Acute	Inhibit	36443709
Lung Neoplasms	Associate	32003423, 35897813
Lupus Erythematosus Systemic	Associate	22966240
Lymphangioleiomyomatosis	Associate	26167915
Lymphatic Metastasis	Associate	19491902, 30994840, 37416767
Lymphatic Metastasis	Stimulate	20574154, 30066902
Melanoma	Associate	16189525, 20484992, 33744299, 39273240
Melanoma	Stimulate	18240291
Moyamoya Disease	Associate	39948449
Multiple Myeloma	Associate	16115125, 37042949
Myelodysplastic Syndromes	Associate	19644139
Myositis Ossificans	Associate	16753021, 30417373
Neoplasm Invasiveness	Associate	20574154
Neoplasm Metastasis	Associate	17855368, 18000500, 19491902, 20388805, 21283680, 22819717, 23311395, 24122992, 24948111, 26167915, 26858249, 28611292, 29039489, 30994840, 39342788
Neoplasm Metastasis	Stimulate	24133588
Neoplasm Metastasis	Inhibit	26869608, 33178820
Neoplasms	Inhibit	12057920
Neoplasms	Associate	12177246, 15026801, 15599381, 15999366, 16115125, 16966095, 17214747, 17426247, 17855368, 18000500, 18240291, 18556654, 18752043, 18842581, 19002177 View all (44 more)
Neoplasms	Stimulate	16189525, 20551950, 29233161
Neural Tube Defects	Associate	19644139
Neuroblastoma	Associate	21506108
Oropharyngeal Neoplasms	Associate	37759448
Osteoarthritis	Associate	27208419
Ovarian Neoplasms	Associate	15599381, 19447105, 20003244, 20796276, 20842131, 23714001, 24662327, 27424980
Pancreatic Neoplasms	Associate	15026801
Pancreatic Neoplasms	Stimulate	18513385
Papillomavirus Infections	Associate	21670698
Peritonitis	Associate	19491902
Personality Disorders	Associate	23517130
Pressure Ulcer	Associate	25820152
Primary Myelofibrosis	Associate	31678370
Prostatic Neoplasms	Inhibit	12057920
Prostatic Neoplasms	Associate	17855368, 18752043, 20388787, 22564737, 23060149, 23342267, 23342268, 24122992, 25031707
Pulmonary Arterial Hypertension	Associate	18436795, 31922883
Renal Insufficiency	Associate	38195505
Sacral defect and anterior sacral meningocele	Associate	35274497
Salivary Gland Neoplasms	Associate	23517130, 27364596
Sarcoma Kaposi	Associate	12719589
Stomach Neoplasms	Associate	15161041, 19491902, 22245935, 23900621
Thyroid Cancer Papillary	Associate	35635748
Thyroid Neoplasms	Associate	22821892, 24069422
Uterine Cervical Dysplasia	Associate	32768930
Uterine Cervical Neoplasms	Associate	19002177, 21670698, 26072160

ID1 (inhibitor of DNA binding 1)