Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID	3397
Gene name	Inhibitor of DNA binding 1
Gene symbol	ID1
Synonyms (NCBI Gene)	IDbHLHb24
Chromosome	20
Chromosome location	20q11.21
Summary	The protein encoded by this gene is a helix-loop-helix (HLH) protein that can form heterodimers with members of the basic HLH family of transcription factors. The encoded protein has no DNA binding activity and therefore can inhibit the DNA binding and tr

Show/Hide all (88)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003418	hsa-miR-100-5p	MicroarrayqRT-PCR	19396866
MIRT004739	hsa-miR-520h	MicroarrayqRT-PCR	19435428
MIRT022546	hsa-miR-124-3p	Microarray	18668037
MIRT024947	hsa-miR-215-5p	Microarray	19074876
MIRT026397	hsa-miR-192-5p	Microarray	19074876
MIRT029333	hsa-miR-26b-5p	Microarray	19088304
MIRT052982	hsa-miR-381-3p	Luciferase reporter assayqRT-PCRWestern blot	22592211
MIRT052982	hsa-miR-381-3p	HITS-CLIP	24374217
MIRT439157	hsa-let-7c-5p	3'LIFE	25074381
MIRT052982	hsa-miR-381-3p	HITS-CLIP	24374217
MIRT439157	hsa-let-7c-5p	3'LIFE	25074381
MIRT736667	hsa-miR-338-5p	Luciferase reporter assayWestern blottingqRT-PCR	31646712
MIRT1058947	hsa-miR-1238	CLIP-seq
MIRT1058948	hsa-miR-1253	CLIP-seq
MIRT1058949	hsa-miR-2054	CLIP-seq
MIRT1058950	hsa-miR-29a	CLIP-seq
MIRT1058951	hsa-miR-29b	CLIP-seq
MIRT1058952	hsa-miR-29c	CLIP-seq
MIRT1058953	hsa-miR-300	CLIP-seq
MIRT1058954	hsa-miR-3200-5p	CLIP-seq
MIRT1058955	hsa-miR-330-3p	CLIP-seq
MIRT736667	hsa-miR-338-5p	CLIP-seq
MIRT1058956	hsa-miR-381	CLIP-seq
MIRT1058957	hsa-miR-4251	CLIP-seq
MIRT1058958	hsa-miR-4289	CLIP-seq
MIRT1058959	hsa-miR-4329	CLIP-seq
MIRT1058960	hsa-miR-4666-3p	CLIP-seq
MIRT1058961	hsa-miR-520d-5p	CLIP-seq
MIRT1058962	hsa-miR-524-5p	CLIP-seq
MIRT1058963	hsa-miR-591	CLIP-seq
MIRT1058964	hsa-miR-2355-5p	CLIP-seq
MIRT1058965	hsa-miR-3127-3p	CLIP-seq
MIRT1058966	hsa-miR-4313	CLIP-seq
MIRT2245849	hsa-miR-1275	CLIP-seq
MIRT2245850	hsa-miR-2117	CLIP-seq
MIRT2245851	hsa-miR-3175	CLIP-seq
MIRT2245852	hsa-miR-3197	CLIP-seq
MIRT2245853	hsa-miR-4273	CLIP-seq
MIRT2245854	hsa-miR-4285	CLIP-seq
MIRT2245855	hsa-miR-4287	CLIP-seq
MIRT2245856	hsa-miR-4330	CLIP-seq
MIRT2245857	hsa-miR-4469	CLIP-seq
MIRT2245858	hsa-miR-4525	CLIP-seq
MIRT2245859	hsa-miR-4665-5p	CLIP-seq
MIRT2245860	hsa-miR-4677-5p	CLIP-seq
MIRT2245861	hsa-miR-4685-3p	CLIP-seq
MIRT2245862	hsa-miR-4713-5p	CLIP-seq
MIRT2245863	hsa-miR-4723-5p	CLIP-seq
MIRT2245864	hsa-miR-625	CLIP-seq
MIRT1058947	hsa-miR-1238	CLIP-seq
MIRT1058948	hsa-miR-1253	CLIP-seq
MIRT2245849	hsa-miR-1275	CLIP-seq
MIRT2437683	hsa-miR-1287	CLIP-seq
MIRT2245850	hsa-miR-2117	CLIP-seq
MIRT1058950	hsa-miR-29a	CLIP-seq
MIRT1058951	hsa-miR-29b	CLIP-seq
MIRT1058952	hsa-miR-29c	CLIP-seq
MIRT2245851	hsa-miR-3175	CLIP-seq
MIRT2245852	hsa-miR-3197	CLIP-seq
MIRT1058954	hsa-miR-3200-5p	CLIP-seq
MIRT1058955	hsa-miR-330-3p	CLIP-seq
MIRT2437684	hsa-miR-3652	CLIP-seq
MIRT2437685	hsa-miR-3677-5p	CLIP-seq
MIRT1058957	hsa-miR-4251	CLIP-seq
MIRT2245853	hsa-miR-4273	CLIP-seq
MIRT2245854	hsa-miR-4285	CLIP-seq
MIRT2245855	hsa-miR-4287	CLIP-seq
MIRT2437686	hsa-miR-4323	CLIP-seq
MIRT1058959	hsa-miR-4329	CLIP-seq
MIRT2245856	hsa-miR-4330	CLIP-seq
MIRT2437687	hsa-miR-4430	CLIP-seq
MIRT2245857	hsa-miR-4469	CLIP-seq
MIRT2245858	hsa-miR-4525	CLIP-seq
MIRT2245859	hsa-miR-4665-5p	CLIP-seq
MIRT2245860	hsa-miR-4677-5p	CLIP-seq
MIRT2245861	hsa-miR-4685-3p	CLIP-seq
MIRT2437688	hsa-miR-4690-3p	CLIP-seq
MIRT2245862	hsa-miR-4713-5p	CLIP-seq
MIRT2245863	hsa-miR-4723-5p	CLIP-seq
MIRT1058961	hsa-miR-520d-5p	CLIP-seq
MIRT1058962	hsa-miR-524-5p	CLIP-seq
MIRT1058963	hsa-miR-591	CLIP-seq
MIRT2245864	hsa-miR-625	CLIP-seq
MIRT2451577	hsa-miR-1825	CLIP-seq
MIRT2451578	hsa-miR-4279	CLIP-seq
MIRT2437688	hsa-miR-4690-3p	CLIP-seq
MIRT2451579	hsa-miR-515-3p	CLIP-seq
MIRT2451580	hsa-miR-519e	CLIP-seq

Show/Hide all (8)

Transcription factor	Regulation	Reference
ATF3	Repression	20565867
ATF5	Repression	18701499
CEBPA	Unknown	22568493
POU2F1	Unknown	19212692
TP53	Unknown	16557594
TRIM28	Unknown	21876767
WHSC1	Unknown	16115125
ZNF382	Repression	20682794

Show/Hide all (44)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	7665172
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	TAS	14522471
GO:0001525	Process	Angiogenesis	TAS	14522471
GO:0001886	Process	Endothelial cell morphogenesis	IEA
GO:0003714	Function	Transcription corepressor activity	IBA
GO:0005515	Function	Protein binding	IPI	15694377, 17855368, 20211142, 20861012, 21988832, 25609649, 26496610, 32296183, 32814053, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IC	15138269
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	TAS	14522471
GO:0007507	Process	Heart development	IEA
GO:0007623	Process	Circadian rhythm	IEA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0030182	Process	Neuron differentiation	IBA
GO:0030509	Process	BMP signaling pathway	IEA
GO:0031648	Process	Protein destabilization	IEA
GO:0032963	Process	Collagen metabolic process	IEA
GO:0043408	Process	Regulation of MAPK cascade	IEA
GO:0043433	Process	Negative regulation of DNA-binding transcription factor activity	IDA	15138269
GO:0043534	Process	Blood vessel endothelial cell migration	TAS	14522471
GO:0045668	Process	Negative regulation of osteoblast differentiation	IEA
GO:0045765	Process	Regulation of angiogenesis	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	15138269
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0046677	Process	Response to antibiotic	IEA
GO:0046983	Function	Protein dimerization activity	IEA
GO:0048511	Process	Rhythmic process	IEA
GO:0048514	Process	Blood vessel morphogenesis	TAS	14522471
GO:0060425	Process	Lung morphogenesis	IEA
GO:0060426	Process	Lung vasculature development	IEA
GO:0072577	Process	Endothelial cell apoptotic process	IEA
GO:0120163	Process	Negative regulation of cold-induced thermogenesis	IEA
GO:0120163	Process	Negative regulation of cold-induced thermogenesis	ISS	28270523
GO:0140416	Function	Transcription regulator inhibitor activity	IDA	7665172
GO:0140416	Function	Transcription regulator inhibitor activity	IEA
GO:2000352	Process	Negative regulation of endothelial cell apoptotic process	IEA

MIM	HGNC	e!Ensembl
600349	5360	ENSG00000125968

P41134

Protein name

DNA-binding protein inhibitor ID-1 (Class B basic helix-loop-helix protein 24) (bHLHb24) (Inhibitor of DNA binding 1) (Inhibitor of differentiation 1)

Protein function

Transcriptional regulator (lacking a basic DNA binding domain) which negatively regulates the basic helix-loop-helix (bHLH) transcription factors by forming heterodimers and inhibiting their DNA binding and transcriptional activity. Implicated i

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00010	HLH	66 → 106	Helix-loop-helix DNA-binding domain	Domain

Sequence

MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQ
QVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGG
RGLPVRAPLSTLNGEISALTAEAACVPADDRILCR

Sequence length

155

Interactions

View interactions

	KEGG		Reactome
	Rap1 signaling pathway TGF-beta signaling pathway Hippo signaling pathway Signaling pathways regulating pluripotency of stem cells		Oncogene Induced Senescence NGF-stimulated transcription

ID1 (inhibitor of DNA binding 1)