Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3396
Gene name	Mitochondrial ribosomal protein L58
Gene symbol	MRPL58
Synonyms (NCBI Gene)	DS-1DS1ICT1MRP-L58mL62
Chromosome	17
Chromosome location	17q25.1
Summary	The protein encoded by this gene is a peptidyl-tRNA hydrolase and a vital component of the large mitochondrial ribosome. The encoded protein serves as a ribosome release factor for this ribosome, which translates mitochondrial genes. This protein may be r

Show/Hide all (22)

miRTarBase ID	miRNA	Experiments	Reference
MIRT078651	hsa-miR-4464	PAR-CLIP	21572407
MIRT078656	hsa-miR-4748	PAR-CLIP	21572407
MIRT078647	hsa-miR-126-5p	PAR-CLIP	21572407
MIRT545088	hsa-miR-549a	PAR-CLIP	21572407
MIRT545087	hsa-miR-7854-3p	PAR-CLIP	21572407
MIRT545086	hsa-miR-6134	PAR-CLIP	21572407
MIRT545085	hsa-miR-374c-5p	PAR-CLIP	21572407
MIRT545084	hsa-miR-655-3p	PAR-CLIP	21572407
MIRT078652	hsa-miR-4477a	PAR-CLIP	21572407
MIRT545083	hsa-miR-514a-3p	PAR-CLIP	21572407
MIRT545082	hsa-miR-514b-3p	PAR-CLIP	21572407
MIRT078651	hsa-miR-4464	PAR-CLIP	21572407
MIRT078656	hsa-miR-4748	PAR-CLIP	21572407
MIRT078647	hsa-miR-126-5p	PAR-CLIP	21572407
MIRT545088	hsa-miR-549a	PAR-CLIP	21572407
MIRT545087	hsa-miR-7854-3p	PAR-CLIP	21572407
MIRT545086	hsa-miR-6134	PAR-CLIP	21572407
MIRT545085	hsa-miR-374c-5p	PAR-CLIP	21572407
MIRT545084	hsa-miR-655-3p	PAR-CLIP	21572407
MIRT078652	hsa-miR-4477a	PAR-CLIP	21572407
MIRT545083	hsa-miR-514a-3p	PAR-CLIP	21572407
MIRT545082	hsa-miR-514b-3p	PAR-CLIP	21572407

Show/Hide all (29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003747	Function	Translation release factor activity	IDA	33878294
GO:0003747	Function	Translation release factor activity	IEA
GO:0004045	Function	Peptidyl-tRNA hydrolase activity	IBA
GO:0004045	Function	Peptidyl-tRNA hydrolase activity	IDA	20186120
GO:0004045	Function	Peptidyl-tRNA hydrolase activity	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA	20186120
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	NAS	27023846
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0005759	Component	Mitochondrial matrix	TAS	33878294
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0005762	Component	Mitochondrial large ribosomal subunit	IBA
GO:0005762	Component	Mitochondrial large ribosomal subunit	IDA	20186120, 25278503
GO:0005762	Component	Mitochondrial large ribosomal subunit	NAS	25278503
GO:0005840	Component	Ribosome	IEA
GO:0005886	Component	Plasma membrane	IDA
GO:0006412	Process	Translation	IEA
GO:0006415	Process	Translational termination	IEA
GO:0016150	Function	Translation release factor activity, codon nonspecific	IBA
GO:0016150	Function	Translation release factor activity, codon nonspecific	IDA	20186120
GO:0016787	Function	Hydrolase activity	IEA
GO:0032543	Process	Mitochondrial translation	NAS	27023846
GO:0070126	Process	Mitochondrial translational termination	IBA
GO:0070126	Process	Mitochondrial translational termination	IDA	20186120
GO:0072344	Process	Rescue of stalled ribosome	IDA	33878294
GO:1990904	Component	Ribonucleoprotein complex	IEA

MIM	HGNC	e!Ensembl
603000	5359	ENSG00000167862

Q14197

Protein name

Large ribosomal subunit protein mL62 (39S ribosomal protein L58, mitochondrial) (MRP-L58) (Digestion substraction 1) (DS-1) (Immature colon carcinoma transcript 1 protein) (Peptidyl-tRNA hydrolase ICT1, mitochondrial) (EC 3.1.1.29)

Protein function

Essential peptidyl-tRNA hydrolase component of the mitochondrial large ribosomal subunit (PubMed:20186120, PubMed:33878294). Acts as a codon-independent translation release factor that has lost all stop codon specificity and directs the terminat

PDB

3J7Y , 3J9M , 5OOL , 5OOM , 6I9R , 6NU2 , 6NU3 , 6VLZ , 6VMI , 6ZM5 , 6ZM6 , 6ZS9 , 6ZSA , 6ZSB , 6ZSC , 6ZSD , 6ZSE , 6ZSG , 7A5F , 7A5G , 7A5H , 7A5I , 7A5J , 7A5K , 7L08 , 7L20 , 7NQL , 7O9K , 7O9M , 7ODR , 7ODS , 7ODT , 7OF0 , 7OF2 , 7OF3 , 7OF4 , 7OF5 , 7OF6 , 7OF7 , 7OG4 , 7OI6 , 7OI7 , 7OI8 , 7OI9 , 7OIA , 7OIB , 7OIC , 7OID , 7OIE , 7PD3 , 7PO4

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00472	RF-1	66 → 201	RF-1 domain	Family

Tissue specificity

TISSUE SPECIFICITY: Down-regulated during the in vitro differentiation of HT29-D4 colon carcinoma cells. {ECO:0000269|PubMed:8575443}.

Sequence

MAATRCLRWGLSRAGVWLLPPPARCPRRALHKQKDGTEFKSIYSLDKLYPESQGSDTAWR
VPNGAKQADSDIPLDRLTISYCRSSGPGGQNVNKVNSKAEVRFHLATAEWIAEPVRQKIA
ITHKNKINRLGELILTSESSRYQFRNLADCLQKIRDMITEASQTPKEPTKEDVKLHRIRI
ENMNRERLRQKRIHSAVKTSRRVDMD

Sequence length

206

Interactions

View interactions

	Reactome
			Mitochondrial translation elongation Mitochondrial translation termination

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DENTAL CARIES	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SMALL VESSEL STROKE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (6)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	24859971	★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Associate	31849952	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastroenteritis	Associate	16415027, 27878638	★★★★★ ★☆☆☆☆ Found in Text Mining only
Infections	Stimulate	26794258	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Associate	24859971	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rotavirus Infections	Associate	32584905, 37569563	★★★★★ ★☆☆☆☆ Found in Text Mining only

MRPL58 (mitochondrial ribosomal protein L58)