RNASE10 (ribonuclease A family member 10 (inactive))

Gene

• Entrez ID: 338879
• Gene name: Ribonuclease A family member 10 (inactive)
• Gene symbol: RNASE10
• Synonyms (NCBI Gene): RAH1, RNASE9
• Chromosome: 14
• Chromosome location: 14q11.2

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT052197	hsa-let-7b-5p	CLASH	23622248

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003676	Function	Nucleic acid binding	IEA
GO:0004540	Function	RNA nuclease activity	IBA
GO:0004540	Function	RNA nuclease activity	IKR	15676279
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	IEA
GO:0007155	Process	Cell adhesion	IEA
GO:0007338	Process	Single fertilization	IEA
GO:0022409	Process	Positive regulation of cell-cell adhesion	ISS
GO:0034113	Process	Heterotypic cell-cell adhesion	ISS
GO:0050830	Process	Defense response to Gram-positive bacterium	IBA
GO:0080154	Process	Regulation of fertilization	ISS
GO:1902093	Process	Positive regulation of flagellated sperm motility	ISS

Other IDs

• MIM: 621046
• HGNC: 19275
• e!Ensembl: ENSG00000182545

Protein

• UniProt ID: Q5GAN6
• Protein name: Inactive ribonuclease-like protein 10
• Protein function: Secreted proximal epididymal protein required for post-testicular sperm maturation and male fertility. May be involved in sperm adhesion to the egg zona pellucida. Does not have ribonuclease activity (By similarity).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00074	RnaseA	99 → 215	Pancreatic ribonuclease	Domain

• Sequence:

  MKLNLVQIFFMLLMLLLGLGMGLGLGLHMATAVLEESDQPLNEFWSSDSQDKAEATEEGD
  GTQTTETLVLSNKEVVQPGWPEDPILGEDEVGGNKMLRASALFQSNKDYLRLDQTDRECN
  DMMAHKMKEPSQSCIAQYAFIHEDLNTVKAVCNSPVIACELKGGKCHKSSRPFDLTLCEL
  SQPDQVTPNCNYLTSVIKKHIIITCNDMKRQLPTGQ

• Sequence length: 216