Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
338645
Gene name Gene Name - the full gene name approved by the HGNC.
Leucine zipper protein 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
LUZP2
Synonyms (NCBI Gene) Gene synonyms aliases
KFSP2566, PRO6246
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11p14.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a leucine zipper protein. This protein is deleted in some patients with Wilms tumor-Aniridia-Genitourinary anomalies-mental Retardation (WAGR) syndrome. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Oct
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT690016 hsa-miR-4768-3p HITS-CLIP 23313552
MIRT690015 hsa-miR-4459 HITS-CLIP 23313552
MIRT690014 hsa-miR-4433a-3p HITS-CLIP 23313552
MIRT690013 hsa-miR-6849-3p HITS-CLIP 23313552
MIRT690012 hsa-miR-544b HITS-CLIP 23313552
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005576 Component Extracellular region IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
608178 23206 ENSG00000187398
Protein
UniProt ID Q86TE4
Protein name Leucine zipper protein 2
Family and domains
Sequence
MKFSPAHYLLPLLPALVLSTRQDYEELEKQLKEVFKERSTILRQLTKTSRELDGIKVNLQ
SLKNDEQSAKTDVQKLLELGQKQREEMKSLQEALQNQLKETSEKAEKHQATINFLKTEVE
RKSKMIRDLQNENKSLKNKLLSGNKLCGIHAEESKKIQAQLKELRYGKKDLLFKAQQLTD
LEQKLAVAKNELEKAALDRESQMKAMKETVQLCLTSVFRDQPPPPLSLITSNPTRMLLPP
RNIASKLPDAAAKSKPQQSASGNNESSQVESTKEGNPSTTACDSQDEGRPCSMKHKESPP
SNATAETEPIPQKLQMPPCSECEVKKAPEKPLTSFEGMAAREEKIL
Sequence length 346
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Alzheimer disease Alzheimer`s Disease rs63750215, rs28936379, rs63749851, rs63749884, rs28936380, rs63750048, rs63750579, rs63750264, rs63749964, rs63750671, rs281865161, rs63750066, rs63750399, rs63750734, rs63751039
View all (65 more)
22881374
Unknown
Disease term Disease name Evidence References Source
Crohn Disease Crohn Disease GWAS
Nasal polyposis Nasal polyposis GWAS
Insomnia Insomnia GWAS
Schizophrenia Schizophrenia GWAS
Associations from Text Mining
Disease Name Relationship Type References
Alzheimer Disease Associate 22881374, 29747637
Carcinoma Non Small Cell Lung Associate 36056349
Infarction Middle Cerebral Artery Associate 29747637
Lymphoma Non Hodgkin Associate 32695826
Neoplasm Metastasis Associate 36056349
Neoplasms Stimulate 27221037
Neoplasms Inhibit 32695826
Obesity Associate 25772781
Prostatic Neoplasms Associate 36124532, 37245085