Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	338599
Gene name Gene Name - the full gene name approved by the HGNC.	Dual specificity phosphatase 29
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	DUSP29
Synonyms (NCBI Gene) Gene synonyms aliases	DUPD1, DUSP27, FMDSP
Chromosome Chromosome number	10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	10q22.2

Show/Hide all(16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000188	Process	Inactivation of MAPK activity	IEA
GO:0004725	Function	Protein tyrosine phosphatase activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	ISS
GO:0005737	Component	Cytoplasm	ISS
GO:0006470	Process	Protein dephosphorylation	IDA	17498703
GO:0008138	Function	Protein tyrosine/serine/threonine phosphatase activity	IDA	17498703
GO:0032991	Component	Protein-containing complex	IDA	21543850
GO:0033549	Function	MAP kinase phosphatase activity	ISS
GO:0035335	Process	Peptidyl-tyrosine dephosphorylation	IEA
GO:0042593	Process	Glucose homeostasis	IEA
GO:0042692	Process	Muscle cell differentiation	ISS
GO:0042803	Function	Protein homodimerization activity	IDA	21543850
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	ISS
GO:0106306	Function	Protein serine phosphatase activity	IEA
GO:0106307	Function	Protein threonine phosphatase activity	IEA

MIM	HGNC	e!Ensembl
618574	23481	ENSG00000188716

Protein

UniProt ID

Q68J44

Protein name

Dual specificity phosphatase 29 (Dual specificity phosphatase 27) (Dual specificity phosphatase DUPD1) (EC 3.1.3.16, EC 3.1.3.48)

Protein function

Dual specificity phosphatase able to dephosphorylate phosphotyrosine, phosphoserine and phosphothreonine residues within the same substrate, with a preference for phosphotyrosine as a substrate (PubMed:17498703). Involved in the modulation of in

PDB

2Y96

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00782	DSPc	62 → 199	Dual specificity phosphatase, catalytic domain	Domain

Sequence

MTSGEVKTSLKNAYSSAKRLSPKMEEEGEEEDYCTPGAFELERLFWKGSPQYTHVNEVWP
KLYIGDEATALDRYRLQKAGFTHVLNAAHGRWNVDTGPDYYRDMDIQYHGVEADDLPTFD
LSVFFYPAAAFIDRALSDDHSKILVHCVMGRSRSATLVLAYLMIHKDMTLVDAIQQVAKN
RCVLPNRGFLKQLRELDKQLVQQRRRSQRQDGEEEDGREL

Sequence length

220

Interactions

View interactions

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Inflammatory bowel disease	Inflammatory Bowel Diseases	rs137853579, rs137853580, rs121909601, rs149491038, rs368287711, rs387907326, rs587777338, rs758439420, rs1329427406, rs1264862631, rs1192830343, rs1373354533, rs1419560997, rs1591263883, rs1989014468	28008999

Show/Hide Unknown Diseases (3)

Disease term	Disease name	Source
Unknown
Ulcerative colitis	Ulcerative colitis	GWAS
Inflammatory Bowel Disease	Inflammatory Bowel Disease	GWAS
Insomnia	Insomnia	GWAS

DUSP29 (dual specificity phosphatase 29)