DUSP29 (dual specificity phosphatase 29)

Gene

• Entrez ID: 338599
• Gene name: Dual specificity phosphatase 29
• Gene symbol: DUSP29
• Synonyms (NCBI Gene): DUPD1, DUSP27, FMDSP
• Chromosome: 10
• Chromosome location: 10q22.2

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004721	Function	Phosphoprotein phosphatase activity	IEA
GO:0004722	Function	Protein serine/threonine phosphatase activity	IEA
GO:0004725	Function	Protein tyrosine phosphatase activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0006470	Process	Protein dephosphorylation	IDA	17498703
GO:0008138	Function	Protein tyrosine/serine/threonine phosphatase activity	IBA
GO:0008138	Function	Protein tyrosine/serine/threonine phosphatase activity	IDA	17498703
GO:0008138	Function	Protein tyrosine/serine/threonine phosphatase activity	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0016791	Function	Phosphatase activity	IEA
GO:0032991	Component	Protein-containing complex	IDA	21543850
GO:0033549	Function	MAP kinase phosphatase activity	IBA
GO:0033549	Function	MAP kinase phosphatase activity	IEA
GO:0033549	Function	MAP kinase phosphatase activity	ISS
GO:0042593	Process	Glucose homeostasis	IEA
GO:0042692	Process	Muscle cell differentiation	IEA
GO:0042692	Process	Muscle cell differentiation	ISS
GO:0042803	Function	Protein homodimerization activity	IDA	21543850
GO:0043409	Process	Negative regulation of MAPK cascade	IBA
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IEA
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	ISS

Other IDs

• MIM: 618574
• HGNC: 23481
• e!Ensembl: ENSG00000188716

Protein

• UniProt ID: Q68J44
• Protein name: Dual specificity phosphatase 29 (Dual specificity phosphatase 27) (Dual specificity phosphatase DUPD1) (EC 3.1.3.16, EC 3.1.3.48)
• Protein function: Dual specificity phosphatase able to dephosphorylate phosphotyrosine, phosphoserine and phosphothreonine residues within the same substrate, with a preference for phosphotyrosine as a substrate (PubMed:17498703). Involved in the modulation of in
• PDB: 2Y96
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00782	DSPc	62 → 199	Dual specificity phosphatase, catalytic domain	Domain

• Sequence:

  MTSGEVKTSLKNAYSSAKRLSPKMEEEGEEEDYCTPGAFELERLFWKGSPQYTHVNEVWP
  KLYIGDEATALDRYRLQKAGFTHVLNAAHGRWNVDTGPDYYRDMDIQYHGVEADDLPTFD
  LSVFFYPAAAFIDRALSDDHSKILVHCVMGRSRSATLVLAYLMIHKDMTLVDAIQQVAKN
  RCVLPNRGFLKQLRELDKQLVQQRRRSQRQDGEEEDGREL

• Sequence length: 220