Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	338596
Gene name Gene Name - the full gene name approved by the HGNC.	ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 6
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ST8SIA6
Synonyms (NCBI Gene) Gene synonyms aliases	SIA8F, SIAT8-F, SIAT8F, ST8SIA-VI, ST8SiaVI
Chromosome Chromosome number	10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	10p12.33
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the glycosyltransferase 29 protein family. Members of this protein family synthesize sialylglycoconjugates. Sialylation may contribute to multidrug resistance in cancer cells. Alternative splicing results in multiple transcri

Show/Hide all(5)

miRTarBase ID	miRNA	Experiments
MIRT2118339	hsa-miR-133a	CLIP-seq
MIRT2118340	hsa-miR-133b	CLIP-seq
MIRT2118341	hsa-miR-4271	CLIP-seq
MIRT2118342	hsa-miR-4725-3p	CLIP-seq
MIRT2118343	hsa-miR-9	CLIP-seq

Show/Hide all(28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0000139	Component	Golgi membrane	TAS
GO:0001574	Process	Ganglioside biosynthetic process	IEA
GO:0001574	Process	Ganglioside biosynthetic process	ISS	11980897
GO:0001835	Process	Blastocyst hatching	IEA
GO:0003828	Function	Alpha-N-acetylneuraminate alpha-2,8-sialyltransferase activity	IBA
GO:0003828	Function	Alpha-N-acetylneuraminate alpha-2,8-sialyltransferase activity	TAS
GO:0005794	Component	Golgi apparatus	IEA
GO:0006486	Process	Protein glycosylation	IBA
GO:0006486	Process	Protein glycosylation	IEA
GO:0006491	Process	N-glycan processing	IBA
GO:0006493	Process	Protein O-linked glycosylation	IEA
GO:0006493	Process	Protein O-linked glycosylation	ISS	11980897
GO:0006629	Process	Lipid metabolic process	IEA
GO:0008373	Function	Sialyltransferase activity	IEA
GO:0008373	Function	Sialyltransferase activity	ISS	11980897
GO:0009100	Process	Glycoprotein metabolic process	IEA
GO:0009100	Process	Glycoprotein metabolic process	ISS	11980897
GO:0009247	Process	Glycolipid biosynthetic process	IEA
GO:0009247	Process	Glycolipid biosynthetic process	ISS	11980897
GO:0009311	Process	Oligosaccharide metabolic process	IBA
GO:0009311	Process	Oligosaccharide metabolic process	IEA
GO:0009311	Process	Oligosaccharide metabolic process	ISS	11980897
GO:0016020	Component	Membrane	IEA
GO:0016051	Process	Carbohydrate biosynthetic process	IEA
GO:0016051	Process	Carbohydrate biosynthetic process	ISS	11980897
GO:0016740	Function	Transferase activity	IEA
GO:0016757	Function	Glycosyltransferase activity	IEA

MIM	HGNC	e!Ensembl
610139	23317	ENSG00000148488

Protein

UniProt ID

P61647

Protein name

Alpha-2,8-sialyltransferase 8F (EC 2.4.99.-) (Sialyltransferase 8F) (SIAT8-F) (Sialyltransferase St8Sia VI) (ST8SiaVI)

Protein function

Alpha-2,8-sialyltransferase that prefers O-glycans to N-glycans or glycolipids as acceptor substrates. The minimal acceptor substrate is the NeuAc-alpha-2,3(6)-Gal sequence at the non-reducing end of their carbohydrate groups. {ECO:0000250|UniPr

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00777	Glyco_transf_29	138 → 392	Glycosyltransferase family 29 (sialyltransferase)	Family

Sequence

MRPGGALLALLASLLLLLLLRLLWCPADAPGRARILVEESREATHGTPAALRTLRSPATA
VPRATNSTYLNEKSLQLTEKCKNLQYGIESFSNKTKGYSENDYLQIITDIQSCPWKRQAE
EYANFRAKLASCCDAVQNFVVSQNNTPVGTNMSYEVESKKEIPIKKNIFHMFPVSQPFVD
YPYNQCAVVGNGGILNKSLCGTEIDKSDFVFRCNLPPTTGDVSKDVGSKTNLVTINPSII
TLKYGNLKEKKALFLEDIATYGDAFFLLPAFSFRANTGTSFKVYYTLEESKARQKVLFFH
PKYLKDLALFWRTKGVTAYRLSTGLMITSVAVELCKNVKLYGFWPFSKTVEDIPVSHHYY
DNKLPKHGFHQMPKEYSQILQLHMKGILKLQFSKCEVA

Sequence length

398

Interactions

View interactions

	Reactome
			Sialic acid metabolism N-Glycan antennae elongation

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Huntington Disease	Huntington's disease progression	N/A	N/A	GWAS

Show/Hide Text Mining Associations (7)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Breast Neoplasms	Associate	30150751, 34894405, 36591654
Carcinoma Hepatocellular	Associate	26516143, 33416148, 36635290
Colorectal Neoplasms	Stimulate	32373956
Colorectal Neoplasms	Associate	39898245
Hypoxia	Associate	33416148
Neoplasms	Associate	26516143, 39898245
Neuroblastoma	Associate	27490539

ST8SIA6 (ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 6)