ICAM3 (intercellular adhesion molecule 3)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3385
Gene name Gene Name - the full gene name approved by the HGNC.
Intercellular adhesion molecule 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ICAM3
Synonyms (NCBI Gene) Gene synonyms aliases
CD50, CDW50, ICAM-R
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19p13.2
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the intercellular adhesion molecule (ICAM) family. All ICAM proteins are type I transmembrane glycoproteins, contain 2-9 immunoglobulin-like C2-type domains, and bind to the leukocyte adhesion LFA-1 protein.
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(5)
miRTarBase ID miRNA Experiments Reference
MIRT026424 hsa-miR-192-5p Microarray 19074876
MIRT442677 hsa-miR-3943 PAR-CLIP 22100165
MIRT442675 hsa-miR-4258 PAR-CLIP 22100165
MIRT442677 hsa-miR-3943 PAR-CLIP 22100165
MIRT442675 hsa-miR-4258 PAR-CLIP 22100165
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(1)
Transcription factor Regulation Reference
RUNX3 Repression 22479382
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(15)
GO ID Ontology Definition Evidence Reference
GO:0005102 Function Signaling receptor binding TAS 8459213
GO:0005178 Function Integrin binding IBA
GO:0005178 Function Integrin binding IEA
GO:0005178 Function Integrin binding IPI 1448173
GO:0005178 Function Integrin binding TAS 1448174
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
146631 5346 ENSG00000076662
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID P32942
Protein name Intercellular adhesion molecule 3 (ICAM-3) (CDw50) (ICAM-R) (CD antigen CD50)
Protein function ICAM proteins are ligands for the leukocyte adhesion protein LFA-1 (integrin alpha-L/beta-2) (PubMed:1448173). ICAM3 is also a ligand for integrin alpha-D/beta-2. In association with integrin alpha-L/beta-2, contributes to apoptotic neutrophil p
PDB 1T0P
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03921 ICAM_N 29 → 119 Intercellular adhesion molecule (ICAM), N-terminal domain Domain
Tissue specificity TISSUE SPECIFICITY: Leukocytes. {ECO:0000269|PubMed:1448173, ECO:0000269|PubMed:23775590}.
Sequence 
MATMVPSVLWPRACWTLLVCCLLTPGVQGQEFLLRVEPQNPVLSAGGSLFVNCSTDCPSS
EKIALETSLSKELVASGMGWAAFNLSNVTGNSRILCSVYCNGSQITGSSNITVYRLPERV
ELAPLPPWQPVGQNFTLRCQVEDGSPRTSLTVVLLRWEEELSRQPAVEEPAEVTATVLAS
RDDHGAPFSCRTELDMQPQGLGLFVNTSAPRQLRTFVLPVTPPRLVAPRFLEVETSWPVD
CTLDGLFPASEAQVYLALGDQMLNATVMNHGDTLTATATATARADQEGAREIVCNVTLGG
ERREARENLTVFSFLGPIVNLSEPTAHEGSTVTVSCMAGARVQVTLDGVPAAAPGQPAQL
QLNATESDDGRSFFCSATLEVDGEFLHRNSSVQLRVLYGPKIDRATCPQHLKWKDKTRHV
LQCQARGNPYPELRCLKEGSSREVPVGIPFFVNVTHNGTYQCQASSSRGKYTLVVVMDIE
AGSSHFVPVFVAVLLTLGVVTIVLALMYVFREHQRSGSYHVREESTYLPLTSMQPTEAMG
EEPSRAE
Sequence length 547
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Cell adhesion molecules   Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Integrin cell surface interactions
CD209 (DC-SIGN) signaling
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Psoriasis Psoriasis N/A N/A GWAS
Show/Hide Text Mining Associations (32)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alopecia Areata Associate 20546884
Autoimmune Diseases Stimulate 8721479
Barrett Esophagus Associate 24474251
Breast Neoplasms Associate 23875900
Cognitive Dysfunction Associate 17903520
Colonic Neoplasms Associate 11169447
Conjunctivitis Allergic Associate 9497473
COVID 19 Inhibit 34824360
Crohn Disease Associate 12594843
Epilepsy Associate 37246165