Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	338440
Gene name	Anoctamin 9
Gene symbol	ANO9
Synonyms (NCBI Gene)	PIG5TMEM16JTP53I5
Chromosome	11
Chromosome location	11p15.5
Summary	The protein encoded by this gene is a member of the TMEM16 (anoctamin) family of proteins, some of which form integral membrane calcium-activated chloride channels. The function of the encoded protein has yet to be elucidated, although it may have channel

Show/Hide all (15)

miRTarBase ID	miRNA	Experiments
MIRT785907	hsa-miR-1233	CLIP-seq
MIRT785908	hsa-miR-3150b-3p	CLIP-seq
MIRT785909	hsa-miR-4474-3p	CLIP-seq
MIRT785910	hsa-miR-4687-5p	CLIP-seq
MIRT785911	hsa-miR-4689	CLIP-seq
MIRT785912	hsa-miR-4784	CLIP-seq
MIRT785913	hsa-miR-544b	CLIP-seq
MIRT785914	hsa-miR-604	CLIP-seq
MIRT785915	hsa-miR-647	CLIP-seq
MIRT1931848	hsa-miR-138	CLIP-seq
MIRT1931849	hsa-miR-3179	CLIP-seq
MIRT1931850	hsa-miR-323-5p	CLIP-seq
MIRT1931851	hsa-miR-4456	CLIP-seq
MIRT785915	hsa-miR-647	CLIP-seq
MIRT1931852	hsa-miR-876-3p	CLIP-seq

Show/Hide all (30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005229	Function	Intracellularly calcium-gated chloride channel activity	IDA	21984732, 22178883
GO:0005229	Function	Intracellularly calcium-gated chloride channel activity	IMP	22946059
GO:0005254	Function	Chloride channel activity	IBA
GO:0005254	Function	Chloride channel activity	TAS
GO:0005262	Function	Calcium channel activity	IEA
GO:0005262	Function	Calcium channel activity	IMP	36520003
GO:0005515	Function	Protein binding	IPI	21525870, 24550280, 32296183
GO:0005783	Component	Endoplasmic reticulum	IDA	36520003
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	22946059, 29604966
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006869	Process	Lipid transport	IEA
GO:0007608	Process	Sensory perception of smell	IEA
GO:0015267	Function	Channel activity	IDA	29604966
GO:0015267	Function	Channel activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0017128	Function	Phospholipid scramblase activity	IEA
GO:0019869	Function	Chloride channel inhibitor activity	IDA	22946059
GO:0034220	Process	Monoatomic ion transmembrane transport	TAS
GO:0046983	Function	Protein dimerization activity	IEA
GO:0051649	Process	Establishment of localization in cell	IEA
GO:0061589	Process	Calcium activated phosphatidylserine scrambling	IEA
GO:0061590	Process	Calcium activated phosphatidylcholine scrambling	IEA
GO:0061591	Process	Calcium activated galactosylceramide scrambling	IEA
GO:0070588	Process	Calcium ion transmembrane transport	IEA
GO:1902476	Process	Chloride transmembrane transport	IBA
GO:1902476	Process	Chloride transmembrane transport	IMP	22946059

MIM	HGNC	e!Ensembl
619963	20679	ENSG00000185101

A1A5B4

Protein name

Anoctamin-9 (Transmembrane protein 16J) (Tumor protein p53-inducible protein 5) (p53-induced gene 5 protein)

Protein function

PKA-activated nonselective cation channel (PubMed:29604966). Discriminates poorly among cations but is more permeable to Ca(2+) ions than to monovalent cations (By similarity). Acts as a calcium-activated calcium permeable channel which may oper

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04547	Anoctamin	179 → 738	Calcium-activated chloride channel	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in the kidney (PubMed:36520003). Expressed in the olfactory epithelium (PubMed:36330924). {ECO:0000269|PubMed:36330924, ECO:0000269|PubMed:36520003}.

Sequence

MQGEESLRILVEPEGDSFPLMEISTCETEASEQWDYVLVAQRHTQRDPRQARQQQFLEEL
RRKGFHIKVIRDQKQVFFGIRADNSVFGLYRTLLLEPEGPAPHAELAAPTTIPVTTSLRI
RIVNFVVMNNKTSAGETFEDLMKDGVFEARFPLHKGEGRLKKTWARWRHMFREQPVDEIR
NYFGEKVALYFVWLGWYTYMLVPAALTGLLVFLSGFSLFEASQISKEICEAHDILMCPLG
DHSRRYQRLSETCTFAKLTHLFDNDGTVVFAIFMALWATVFLEIWKRQRARVVLHWDLYV
WDEEQEEMALQLINCPDYKLRPYQHSYLRSTVILVLTLLMICLMIGMAHVLVVYRVLASA
LFSSSAVPFLEEQVTTAVVVTGALVHYVTIIIMTKINRCVALKLCDFEMPRTFSERESRF
TIRFFTLQFFTHFSSLIYIAFILGRINGHPGKSTRLAGLWKLEECHASGCMMDLFVQMAI
IMGLKQTLSNCVEYLVPWVTHKCRSLRASESGHLPRDPELRDWRRNYLLNPVNTFSLFDE
FMEMMIQYGFTTIFVAAFPLAPLLALFSNLVEIRLDAIKMVWLQRRLVPRKAKDIGTWLQ
VLETIGVLAVIANGMVIAFTSEFIPRVVYKYRYSPCLKEGNSTVDCLKGYVNHSLSVFHT
KDFQDPDGIEGSENVTLCRYRDYRNPPDYNFSEQFWFLLAIRLAFVILFEHVALCIKLIA
AWFVPDIPQSVKNKVLEVKYQRLREKMWHGRQRLGGVGAGSRPPMPAHPTPASIFSARST
DV

Sequence length

782

Interactions

View interactions

	KEGG		Reactome
	Efferocytosis		Stimuli-sensing channels

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Prostate cancer	Uncertain significance	rs193920739	RCV000149027

Show/Hide Text Mining Associations (10)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Colorectal Neoplasms	Associate	26317553
Death	Associate	26872154
HIV Infections	Associate	26872154
Neoplasm Metastasis	Associate	26317553
Neoplasms	Inhibit	26317553
Neoplasms	Associate	33404124
Stomach Neoplasms	Associate	33404124
Tuberculosis	Associate	22223854, 26872154
Tuberculosis Meningeal	Associate	22223854, 26872154
Tuberculosis Pulmonary	Associate	22223854

ANO9 (anoctamin 9)