ICAM2 (intercellular adhesion molecule 2)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3384
Gene name Gene Name - the full gene name approved by the HGNC.
Intercellular adhesion molecule 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ICAM2
Synonyms (NCBI Gene) Gene synonyms aliases
CD102
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q23.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the intercellular adhesion molecule (ICAM) family. All ICAM proteins are type I transmembrane glycoproteins, contain 2-9 immunoglobulin-like C2-type domains, and bind to the leukocyte adhesion LFA-1 protein.
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(12)
miRTarBase ID miRNA Experiments Reference
MIRT054251 hsa-miR-125b-5p Luciferase reporter assay, QRTPCR 23591197
MIRT1058572 hsa-miR-145 CLIP-seq
MIRT1058573 hsa-miR-1825 CLIP-seq
MIRT1058574 hsa-miR-199a-5p CLIP-seq
MIRT1058575 hsa-miR-199b-5p CLIP-seq
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(1)
Transcription factor Regulation Reference
ERG Unknown 10574717;19359602
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(13)
GO ID Ontology Definition Evidence Reference
GO:0001931 Component Uropod IEA
GO:0002223 Process Stimulatory C-type lectin receptor signaling pathway TAS
GO:0005178 Function Integrin binding IBA 21873635
GO:0005178 Function Integrin binding IPI 1448173
GO:0005886 Component Plasma membrane TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
146630 5345 ENSG00000108622
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID P13598
Protein name Intercellular adhesion molecule 2 (ICAM-2) (CD antigen CD102)
Protein function ICAM proteins are ligands for the leukocyte adhesion protein LFA-1 (integrin alpha-L/beta-2). ICAM2 may play a role in lymphocyte recirculation by blocking LFA-1-dependent cell adhesion. It mediates adhesive interactions important for antigen-sp
PDB 1ZXQ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03921 ICAM_N 24 → 114 Intercellular adhesion molecule (ICAM), N-terminal domain Domain
Sequence 
MSSFGYRTLTVALFTLICCPGSDEKVFEVHVRPKKLAVEPKGSLEVNCSTTCNQPEVGGL
ETSLDKILLDEQAQWKHYLVSNISHDTVLQCHFTCSGKQESMNSNVSVYQPPRQVILTLQ
PTLVAVGKSFTIECRVPTVEPLDSLTLFLFRGNETLHYETFGKAAPAPQEATATFNSTAD
REDGHRNFSCLAVLDLMSRGGNIFHKHSAPKMLEIYEPVSDSQMVIIVTVVSVLLSLFVT
SVLLCFIFGQHLRQQRMGTYGVRAAWRRLPQAFRP
Sequence length 275
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Cell adhesion molecules
Natural killer cell mediated cytotoxicity 		  Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Integrin cell surface interactions
CD209 (DC-SIGN) signaling
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Gastric cancer Hereditary Diffuse Gastric Cancer rs137854571, rs63751108, rs34612342, rs121908383, rs121909144, rs121909775, rs121909219, rs121909223, rs63750871, rs80359530, rs121964873, rs121913530, rs606231203, rs121918505, rs587776802
View all (244 more)		 16367923
Show/Hide Text Mining Associations (34)
Associations from Text Mining
Disease Name Relationship Type References
Alopecia Areata Associate 20546884
Barrett Esophagus Associate 24474251
Carcinoma Hepatocellular Associate 27592383
Carcinoma Squamous Cell Associate 37177979
Carotid Stenosis Associate 36187128
Cerebral Infarction Associate 31168961
Cognitive Dysfunction Associate 17903520
Colonic Neoplasms Associate 11169447
Conjunctivitis Allergic Stimulate 26989694
COVID 19 Associate 38575325