ICAM2 (intercellular adhesion molecule 2)

Gene Gene information from NCBI Gene database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 3384
Gene name Intercellular adhesion molecule 2
Gene symbol ICAM2
Synonyms (NCBI Gene)
CD102
Chromosome 17
Chromosome location 17q23.3
Summary The protein encoded by this gene is a member of the intercellular adhesion molecule (ICAM) family. All ICAM proteins are type I transmembrane glycoproteins, contain 2-9 immunoglobulin-like C2-type domains, and bind to the leukocyte adhesion LFA-1 protein.
miRNA miRNA information provided by mirtarbase database.
12
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (12)
miRTarBase ID miRNA Experiments Reference
MIRT054251 hsa-miR-125b-5p Luciferase reporter assayQRTPCR 23591197
MIRT1058572 hsa-miR-145 CLIP-seq
MIRT1058573 hsa-miR-1825 CLIP-seq
MIRT1058574 hsa-miR-199a-5p CLIP-seq
MIRT1058575 hsa-miR-199b-5p CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (1)
Transcription factor Regulation Reference
ERG Unknown 10574717;19359602
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
18
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (18)
GO ID Ontology Definition Evidence Reference
GO:0001931 Component Uropod IEA
GO:0005178 Function Integrin binding IBA
GO:0005178 Function Integrin binding IEA
GO:0005178 Function Integrin binding IPI 1448173
GO:0005178 Function Integrin binding TAS 2497351
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
146630 5345 ENSG00000108622
Protein Protein information from UniProt database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P13598
Protein name Intercellular adhesion molecule 2 (ICAM-2) (CD antigen CD102)
Protein function ICAM proteins are ligands for the leukocyte adhesion protein LFA-1 (integrin alpha-L/beta-2). ICAM2 may play a role in lymphocyte recirculation by blocking LFA-1-dependent cell adhesion. It mediates adhesive interactions important for antigen-sp
PDB 1ZXQ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03921 ICAM_N 24 → 114 Intercellular adhesion molecule (ICAM), N-terminal domain Domain
Sequence 
MSSFGYRTLTVALFTLICCPGSDEKVFEVHVRPKKLAVEPKGSLEVNCSTTCNQPEVGGL
ETSLDKILLDEQAQWKHYLVSNISHDTVLQCHFTCSGKQESMNSNVSVYQPPRQVILTLQ
PTLVAVGKSFTIECRVPTVEPLDSLTLFLFRGNETLHYETFGKAAPAPQEATATFNSTAD
REDGHRNFSCLAVLDLMSRGGNIFHKHSAPKMLEIYEPVSDSQMVIIVTVVSVLLSLFVT
SVLLCFIFGQHLRQQRMGTYGVRAAWRRLPQAFRP
Sequence length 275
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  Reactome
  Cell adhesion molecules
Natural killer cell mediated cytotoxicity 		  Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Integrin cell surface interactions
CD209 (DC-SIGN) signaling
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Uterine corpus endometrial carcinoma Uncertain significance rs752187014 RCV005932383
Show/Hide Text Mining Associations (34)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Alopecia Areata Associate 20546884
Barrett Esophagus Associate 24474251
Carcinoma Hepatocellular Associate 27592383
Carcinoma Squamous Cell Associate 37177979
Carotid Stenosis Associate 36187128
Cerebral Infarction Associate 31168961
Cognitive Dysfunction Associate 17903520
Colonic Neoplasms Associate 11169447
Conjunctivitis Allergic Stimulate 26989694
COVID 19 Associate 38575325