Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	338382
Gene name Gene Name - the full gene name approved by the HGNC.	RAB7B, member RAS oncogene family
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	RAB7B
Synonyms (NCBI Gene) Gene synonyms aliases	RAB7
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1q32.1

Show/Hide all(3)

miRTarBase ID	miRNA	Experiments	Reference
MIRT726808	hsa-miR-92a-3p	HITS-CLIP	22473208
MIRT726806	hsa-miR-92b-3p	HITS-CLIP	22473208
MIRT726807	hsa-miR-32-5p	HITS-CLIP	22473208

Show/Hide all(23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003924	Function	GTPase activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005525	Function	GTP binding	IEA
GO:0005764	Component	Lysosome	IBA	21873635
GO:0005764	Component	Lysosome	IDA	20375062
GO:0005770	Component	Late endosome	IBA	21873635
GO:0005770	Component	Late endosome	IDA	20375062
GO:0005794	Component	Golgi apparatus	IDA	20375062
GO:0005802	Component	Trans-Golgi network	IDA	20375062
GO:0008333	Process	Endosome to lysosome transport	IBA	21873635
GO:0015031	Process	Protein transport	IEA
GO:0030670	Component	Phagocytic vesicle membrane	IEA
GO:0031902	Component	Late endosome membrane	TAS
GO:0032755	Process	Positive regulation of interleukin-6 production	IMP	20953574
GO:0034144	Process	Negative regulation of toll-like receptor 4 signaling pathway	ISS
GO:0034164	Process	Negative regulation of toll-like receptor 9 signaling pathway	ISS
GO:0034499	Process	Late endosome to Golgi transport	IMP	20375062
GO:0045335	Component	Phagocytic vesicle	IBA	21873635
GO:0045335	Component	Phagocytic vesicle	IDA	21255211
GO:0045654	Process	Positive regulation of megakaryocyte differentiation	IMP	20953574
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IMP	20953574
GO:0071346	Process	Cellular response to interferon-gamma	IEA
GO:0090385	Process	Phagosome-lysosome fusion	IBA	21873635

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Protein

UniProt ID

Q96AH8

Protein name

Ras-related protein Rab-7b

Protein function

Controls vesicular trafficking from endosomes to the trans-Golgi network (TGN). Acts as a negative regulator of TLR9 signaling and can suppress TLR9-triggered TNFA, IL6, and IFNB production in macrophages by promoting TLR9 lysosomal degradation.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00071	Ras	10 → 173	Ras family	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in heart, placenta, lung, skeletal muscle and peripheral blood leukocyte. {ECO:0000269|PubMed:15144907}.

Sequence

MNPRKKVDLKLIIVGAIGVGKTSLLHQYVHKTFYEEYQTTLGASILSKIIILGDTTLKLQ
IWDTGGQERFRSMVSTFYKGSDGCILAFDVTDLESFEALDIWRGDVLAKIVPMEQSYPMV
LLGNKIDLADRKVPQEVAQGWCREKDIPYFEVSAKNDINVVQAFEMLASRALSRYQSILE
NHLTESIKLSPDQSRSRCC

Sequence length

199

Interactions

View interactions

	KEGG		Reactome
	Mitophagy - animal Autophagy - animal Phagosome Efferocytosis Salmonella infection Amoebiasis		TBC/RABGAPs RAB geranylgeranylation RAB GEFs exchange GTP for GDP on RABs

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Osteoporosis	Osteoporosis, Age-Related, Osteoporosis, Osteoporosis, Senile, Post-Traumatic Osteoporosis	rs72658152, rs72667023, rs587776916, rs72656370, rs768615287	18924182

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Coronary syndrome	Acute Coronary Syndrome		21751358	ClinVar

Show/Hide Text Mining Associations (43)

Disease Name	Relationship Type	References
Associations from Text Mining
Acute Coronary Syndrome	Associate	24736723
Adenoma	Stimulate	12034881
Alzheimer Disease	Associate	18535180
Alzheimer Disease	Stimulate	20655510, 20847427, 21669283
Aortic Dissection	Stimulate	30816458
Arthritis Infectious	Associate	35371338
Breast Neoplasms	Inhibit	33633298
Calcinosis Cutis	Associate	26110570
Ceroid lipofuscinosis neuronal 5	Associate	22431521
Charcot Marie Tooth Disease	Associate	26362287
Charcot Marie Tooth disease Type 2B	Associate	18272684, 19651702, 20028791, 26362287, 35851620
Cholangiocarcinoma	Stimulate	28946560
Choroideremia	Associate	15186776
Cognition Disorders	Stimulate	20655510, 21669283
Cognition Disorders	Associate	20847427
Cognitive Dysfunction	Stimulate	20847427, 21669283
COVID 19	Associate	33541739, 35840993
Cystic Fibrosis	Associate	23316065
Down Syndrome	Associate	18535180
Drug Related Side Effects and Adverse Reactions	Inhibit	25721868
Foot Injuries	Associate	15965219
Gaucher Disease	Associate	28011901
Hepatolenticular Degeneration	Associate	15681833
Inflammation	Associate	28011901
Inflammation	Inhibit	39209027
Leukemia	Associate	9428630
Light Fixation Seizure Syndrome	Associate	27242226
Lymphatic Metastasis	Stimulate	32591494
Mitochondrial Diseases	Associate	35851620
Muscle Weakness	Associate	15965219
Myopathy with Abnormal Lipid Metabolism	Associate	12070301
Neoplasms	Associate	20015112, 31517637, 32479595, 32591494, 33633298, 33633443, 9428630
Nerve Degeneration	Associate	20028791
Niemann Pick Disease Type C	Associate	12070301
Ovarian Neoplasms	Associate	24769729
Pancreatic Neoplasms	Associate	32499447
Peripheral Nervous System Diseases	Associate	19651702, 35851620
Respiratory Distress Syndrome	Inhibit	35371338
Squamous Cell Carcinoma of Head and Neck	Associate	26110570
Stomach Neoplasms	Associate	32591494
Thyroid Neoplasms	Associate	12034881
Triple Negative Breast Neoplasms	Associate	31662325
Virus Diseases	Associate	27791088

RAB7B (RAB7B, member RAS oncogene family)