Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	338382
Gene name Gene Name - the full gene name approved by the HGNC.	RAB7B, member RAS oncogene family
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	RAB7B
Synonyms (NCBI Gene) Gene synonyms aliases	RAB7
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1q32.1

Show/Hide all(3)

miRTarBase ID	miRNA	Experiments	Reference
MIRT726808	hsa-miR-92a-3p	HITS-CLIP	22473208
MIRT726806	hsa-miR-92b-3p	HITS-CLIP	22473208
MIRT726807	hsa-miR-32-5p	HITS-CLIP	22473208

Show/Hide all(35)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0002682	Process	Regulation of immune system process	IEA
GO:0003924	Function	GTPase activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005525	Function	GTP binding	IEA
GO:0005764	Component	Lysosome	IBA
GO:0005764	Component	Lysosome	IDA	20375062
GO:0005764	Component	Lysosome	IEA
GO:0005768	Component	Endosome	IEA
GO:0005770	Component	Late endosome	IBA
GO:0005770	Component	Late endosome	IDA	20375062
GO:0005770	Component	Late endosome	IEA
GO:0005794	Component	Golgi apparatus	IDA	20375062
GO:0005794	Component	Golgi apparatus	IEA
GO:0005802	Component	Trans-Golgi network	IDA	20375062
GO:0008333	Process	Endosome to lysosome transport	IBA
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0030670	Component	Phagocytic vesicle membrane	IEA
GO:0031090	Component	Organelle membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031902	Component	Late endosome membrane	TAS
GO:0032755	Process	Positive regulation of interleukin-6 production	IMP	20953574
GO:0034144	Process	Negative regulation of toll-like receptor 4 signaling pathway	IEA
GO:0034144	Process	Negative regulation of toll-like receptor 4 signaling pathway	ISS
GO:0034164	Process	Negative regulation of toll-like receptor 9 signaling pathway	IEA
GO:0034164	Process	Negative regulation of toll-like receptor 9 signaling pathway	ISS
GO:0034499	Process	Late endosome to Golgi transport	IMP	20375062
GO:0045335	Component	Phagocytic vesicle	IBA
GO:0045335	Component	Phagocytic vesicle	IDA	21255211
GO:0045335	Component	Phagocytic vesicle	IEA
GO:0045654	Process	Positive regulation of megakaryocyte differentiation	IMP	20953574
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IMP	20953574
GO:0071346	Process	Cellular response to type II interferon	IEA
GO:0090385	Process	Phagosome-lysosome fusion	IBA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Protein

UniProt ID

Q96AH8

Protein name

Ras-related protein Rab-7b

Protein function

Controls vesicular trafficking from endosomes to the trans-Golgi network (TGN). Acts as a negative regulator of TLR9 signaling and can suppress TLR9-triggered TNFA, IL6, and IFNB production in macrophages by promoting TLR9 lysosomal degradation.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00071	Ras	10 → 173	Ras family	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in heart, placenta, lung, skeletal muscle and peripheral blood leukocyte. {ECO:0000269|PubMed:15144907}.

Sequence

MNPRKKVDLKLIIVGAIGVGKTSLLHQYVHKTFYEEYQTTLGASILSKIIILGDTTLKLQ
IWDTGGQERFRSMVSTFYKGSDGCILAFDVTDLESFEALDIWRGDVLAKIVPMEQSYPMV
LLGNKIDLADRKVPQEVAQGWCREKDIPYFEVSAKNDINVVQAFEMLASRALSRYQSILE
NHLTESIKLSPDQSRSRCC

Sequence length

199

Interactions

View interactions

	KEGG		Reactome
	Mitophagy - animal Autophagy - animal Phagosome Efferocytosis Salmonella infection Amoebiasis		TBC/RABGAPs RAB geranylgeranylation RAB GEFs exchange GTP for GDP on RABs

RAB7B (RAB7B, member RAS oncogene family)