Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
338328
Gene name Gene Name - the full gene name approved by the HGNC.
Glycosylphosphatidylinositol anchored high density lipoprotein binding protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
GPIHBP1
Synonyms (NCBI Gene) Gene synonyms aliases
GPI-HBP1, HYPL1D
Chromosome Chromosome number
8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8q24.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a capillary endothelial cell protein that facilitates the lipolytic processing of triglyceride-rich lipoproteins. The encoded protein is a glycosylphosphatidylinositol-anchored protein that is a member of the lymphocyte antigen 6 (Ly6) f
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs145844329 G>A,C Pathogenic-likely-pathogenic, likely-benign Coding sequence variant, missense variant, intron variant
rs587777637 A>C Pathogenic Missense variant, coding sequence variant
rs587777638 G>A,C Pathogenic Missense variant, coding sequence variant
rs587777639 T>C,G Pathogenic Missense variant, coding sequence variant
rs587777640 G>T Pathogenic Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT017452 hsa-miR-335-5p Microarray 18185580
MIRT458115 hsa-miR-8080 PAR-CLIP 23592263
MIRT458114 hsa-miR-552-3p PAR-CLIP 23592263
MIRT458113 hsa-miR-1197 PAR-CLIP 23592263
MIRT458112 hsa-miR-4434 PAR-CLIP 23592263
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 20124439, 30559189, 32814053
GO:0005576 Component Extracellular region TAS
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane IEA
GO:0005886 Component Plasma membrane TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
612757 24945 ENSG00000277494
Protein
UniProt ID Q8IV16
Protein name Glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1 (GPI-HBP1) (GPI-anchored HDL-binding protein 1) (High density lipoprotein-binding protein 1)
Protein function Mediates the transport of lipoprotein lipase LPL from the basolateral to the apical surface of endothelial cells in capillaries (By similarity). Anchors LPL on the surface of endothelial cells in the lumen of blood capillaries (By similarity). P
PDB 6E7K , 6OAU , 6OAZ , 6OB0
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00021 UPAR_LY6 65 137 u-PAR/Ly-6 domain Domain
Sequence
MKALGAVLLALLLCGRPGRGQTQQEEEEEDEDHGPDDYDEEDEDEVEEEETNRLPGGRSR
VLLRCYTCKSLPRDERCNLTQNCSHGQTCTTLIAHGNTESGLLTTHSTWCTDSCQPITKT
VEGTQVTMTCCQSSLCN
VPPWQSSRVQDPTGKGAGGPRGSSETVGAALLLNLLAGLGAMG
ARRP
Sequence length 184
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Post-translational modification: synthesis of GPI-anchored proteins
Assembly of active LPL and LIPC lipase complexes
Chylomicron remodeling
Retinoid metabolism and transport
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Hyperlipoproteinemia Hyperlipoproteinemia, type 1D, Hyperlipoproteinemia, type I rs587777637, rs587777638, rs587777639, rs587777640, rs587777641, rs587777642, rs587777643 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Diabetes Triglyceride levels in non-type 2 diabetes N/A N/A GWAS
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS
Schizophrenia Schizophrenia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Atherosclerosis Associate 23831619
Breast Neoplasms Associate 31182966
Colitis Associate 24614124
Coronary Artery Disease Associate 23831619
Familial hyperchylomicronemia syndrome Associate 27403930, 29659879, 36613909
Hyperlipidemias Associate 24646025
Hyperlipoproteinemia Type I Associate 22008945, 23831619, 24847059, 26079787, 29288010, 29748148, 32375710, 36978188
Hypertriglyceridemia Associate 22008945, 23831619, 24614124, 24847059, 26079787, 29910226, 29921298, 30885219, 32115487, 36613909, 37981531
Hypertriglyceridemic Waist Associate 24847059
Immunologic Deficiency Syndromes Inhibit 22008945