Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
338324
Gene name Gene Name - the full gene name approved by the HGNC.
S100 calcium binding protein A7A
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
S100A7A
Synonyms (NCBI Gene) Gene synonyms aliases
NICE-2, NICE2, S100A15, S100A7L1, S100A7f
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q21.3
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT030254 hsa-miR-26b-5p Microarray 19088304
MIRT646032 hsa-miR-216b-5p HITS-CLIP 23824327
MIRT646031 hsa-miR-130b-5p HITS-CLIP 23824327
MIRT646030 hsa-miR-3167 HITS-CLIP 23824327
MIRT646029 hsa-miR-876-5p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005509 Function Calcium ion binding IBA
GO:0005509 Function Calcium ion binding IEA
GO:0005515 Function Protein binding IPI 32296183
GO:0005737 Component Cytoplasm IBA
GO:0005737 Component Cytoplasm IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
617427 21657 ENSG00000184330
Protein
UniProt ID Q86SG5
Protein name Protein S100-A7A (S100 calcium-binding protein A15) (S100 calcium-binding protein A7-like 1) (S100 calcium-binding protein A7A)
Protein function May be involved in epidermal differentiation and inflammation and might therefore be important for the pathogenesis of psoriasis and other diseases.
PDB 4AQI
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01023 S_100 6 45 S-100/ICaBP type calcium binding domain Domain
Tissue specificity TISSUE SPECIFICITY: Overexpressed in psoriasis.
Sequence
MSNTQAERSIIGMIDMFHKYTGRDGKIEKPSLLTMMKENFPNFLSACDKKGIHYLATVFE
KKDKNEDKKIDFSEFLSLLGDIAADYHKQSHGAAPCSGGSQ
Sequence length 101
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  IL-17 signaling pathway   Metal sequestration by antimicrobial proteins
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Mastocytosis Mastocytosis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 28498804
Arthritis Psoriatic Associate 22402441
Breast Neoplasms Stimulate 19136201
Carcinoma Hepatocellular Associate 33546025
Carcinoma Non Small Cell Lung Associate 23451142
Cholesteatoma Associate 25093596
Esophageal Neoplasms Associate 36588538
Inflammation Associate 25093596
Leukemia Myeloid Acute Associate 31919040
Lung Neoplasms Associate 28498804