Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3383
Gene name Gene Name - the full gene name approved by the HGNC.
Intercellular adhesion molecule 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ICAM1
Synonyms (NCBI Gene) Gene synonyms aliases
BB2, CD54, P3.58
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19p13.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a cell surface glycoprotein which is typically expressed on endothelial cells and cells of the immune system. It binds to integrins of type CD11a / CD18, or CD11b / CD18 and is also exploited by Rhinovirus as a receptor. [provided by Ref
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs5491 A>G,T Risk-factor Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT004430 hsa-miR-221-3p Luciferase reporter assay, Western blot 20110463
MIRT004430 hsa-miR-221-3p Luciferase reporter assay, Western blot 20110463
MIRT004595 hsa-miR-222-3p Review 20144731
MIRT004596 hsa-miR-339-5p Review 20144731
MIRT004020 hsa-miR-17-3p Immunocytochemistry, Northern blot, qRT-PCR, Western blot 19949084
Transcription factors
Transcription factor Regulation Reference
CEBPA Unknown 9916895
ERG Repression 22235125
ETS2 Activation 9572487
ETV5 Activation 9572487
HDAC1 Activation 12490396
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001618 Function Virus receptor activity IEA
GO:0001772 Component Immunological synapse IEA
GO:0001910 Process Regulation of leukocyte mediated cytotoxicity TAS 16038038
GO:0002252 Process Immune effector process IEA
GO:0002291 Process T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell IMP 2477710
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
147840 5344 ENSG00000090339
Protein
UniProt ID P05362
Protein name Intercellular adhesion molecule 1 (ICAM-1) (Major group rhinovirus receptor) (CD antigen CD54)
Protein function ICAM proteins are ligands for the leukocyte adhesion protein LFA-1 (integrin alpha-L/beta-2). During leukocyte trans-endothelial migration, ICAM1 engagement promotes the assembly of endothelial apical cups through ARHGEF26/SGEF and RHOG activati
PDB 1D3E , 1D3I , 1D3L , 1IAM , 1IC1 , 1MQ8 , 1P53 , 1Z7Z , 2OZ4 , 3TCX , 5MZA , 6EIT , 6S8U , 7BG7
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03921 ICAM_N 24 115 Intercellular adhesion molecule (ICAM), N-terminal domain Domain
Sequence
MAPSSPRPALPALLVLLGALFPGPGNAQTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGI
ETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPER
VELAP
LPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHH
GANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLD
GLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQE
TLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKA
TPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQ
AWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYE
IVIITVVAAAVIMGTAGLSTYLYNRQRKIKKYRLQQAQKGTPMKPNTQATPP
Sequence length 532
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  NF-kappa B signaling pathway
Cell adhesion molecules
Natural killer cell mediated cytotoxicity
TNF signaling pathway
Leukocyte transendothelial migration
AGE-RAGE signaling pathway in diabetic complications
African trypanosomiasis
Malaria
Staphylococcus aureus infection
Influenza A
Human T-cell leukemia virus 1 infection
Kaposi sarcoma-associated herpesvirus infection
Epstein-Barr virus infection
Rheumatoid arthritis
Viral myocarditis
Lipid and atherosclerosis
Fluid shear stress and atherosclerosis
  Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Integrin cell surface interactions
Interleukin-10 signaling
Interleukin-4 and Interleukin-13 signaling
Interferon gamma signaling
<