Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3383
Gene name	Intercellular adhesion molecule 1
Gene symbol	ICAM1
Synonyms (NCBI Gene)	BB2CD54P3.58
Chromosome	19
Chromosome location	19p13.2
Summary	This gene encodes a cell surface glycoprotein which is typically expressed on endothelial cells and cells of the immune system. It binds to integrins of type CD11a / CD18, or CD11b / CD18 and is also exploited by Rhinovirus as a receptor. [provided by Ref

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs5491	A>G,T	Risk-factor	Coding sequence variant, missense variant

581

Show/Hide all (581)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004430	hsa-miR-221-3p	Luciferase reporter assayWestern blot	20110463
MIRT004430	hsa-miR-221-3p	Luciferase reporter assayWestern blot	20110463
MIRT004595	hsa-miR-222-3p	Review	20144731
MIRT004596	hsa-miR-339-5p	Review	20144731
MIRT004020	hsa-miR-17-3p	ImmunocytochemistryNorthern blotqRT-PCRWestern blot	19949084
MIRT005707	hsa-miR-31-5p	Luciferase reporter assay	19949084
MIRT005708	hsa-miR-17-5p	Luciferase reporter assay	19949084
MIRT005709	hsa-miR-155-5p	Luciferase reporter assay	19949084
MIRT004430	hsa-miR-221-3p	Luciferase reporter assay	19949084
MIRT004595	hsa-miR-222-3p	Luciferase reporter assay	19949084
MIRT005710	hsa-miR-1256	Luciferase reporter assay	19949084
MIRT005952	hsa-miR-21-5p	Luciferase reporter assayMicroarrayqRT-PCR	21131358
MIRT018131	hsa-miR-335-5p	Microarray	18185580
MIRT005709	hsa-miR-155-5p	qRT-PCR	21310411
MIRT027615	hsa-miR-98-5p	Microarray	19088304
MIRT054757	hsa-miR-146a-5p	QRTPCRWestern blot	24867582
MIRT438044	hsa-miR-324-3p	qRT-PCR	24367666
MIRT438035	hsa-miR-93-5p	qRT-PCR	24367666
MIRT438044	hsa-miR-324-3p	qRT-PCR	24367666
MIRT438035	hsa-miR-93-5p	qRT-PCR	24367666
MIRT611897	hsa-miR-8485	HITS-CLIP	19536157
MIRT611896	hsa-miR-329-3p	HITS-CLIP	19536157
MIRT611895	hsa-miR-362-3p	HITS-CLIP	19536157
MIRT611894	hsa-miR-603	HITS-CLIP	19536157
MIRT611892	hsa-miR-3186-3p	HITS-CLIP	19536157
MIRT611888	hsa-miR-1255a	HITS-CLIP	19536157
MIRT611887	hsa-miR-1255b-5p	HITS-CLIP	19536157
MIRT611886	hsa-miR-3941	HITS-CLIP	19536157
MIRT611897	hsa-miR-8485	HITS-CLIP	23824327
MIRT611896	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611895	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611894	hsa-miR-603	HITS-CLIP	23824327
MIRT611893	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT611892	hsa-miR-3186-3p	HITS-CLIP	23824327
MIRT611891	hsa-miR-3975	HITS-CLIP	23824327
MIRT611890	hsa-miR-2467-5p	HITS-CLIP	23824327
MIRT611889	hsa-miR-3188	HITS-CLIP	23824327
MIRT611888	hsa-miR-1255a	HITS-CLIP	23824327
MIRT611887	hsa-miR-1255b-5p	HITS-CLIP	23824327
MIRT611886	hsa-miR-3941	HITS-CLIP	23824327
MIRT611897	hsa-miR-8485	HITS-CLIP	23824327
MIRT611896	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611895	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611894	hsa-miR-603	HITS-CLIP	23824327
MIRT611893	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT611892	hsa-miR-3186-3p	HITS-CLIP	23824327
MIRT611888	hsa-miR-1255a	HITS-CLIP	23824327
MIRT611887	hsa-miR-1255b-5p	HITS-CLIP	23824327
MIRT611886	hsa-miR-3941	HITS-CLIP	23824327
MIRT611897	hsa-miR-8485	HITS-CLIP	23824327
MIRT611896	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611895	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611894	hsa-miR-603	HITS-CLIP	23824327
MIRT611893	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT611892	hsa-miR-3186-3p	HITS-CLIP	23824327
MIRT611888	hsa-miR-1255a	HITS-CLIP	23824327
MIRT611887	hsa-miR-1255b-5p	HITS-CLIP	23824327
MIRT611886	hsa-miR-3941	HITS-CLIP	23824327
MIRT611897	hsa-miR-8485	HITS-CLIP	23824327
MIRT611896	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611895	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611894	hsa-miR-603	HITS-CLIP	23824327
MIRT611893	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT611892	hsa-miR-3186-3p	HITS-CLIP	23824327
MIRT611888	hsa-miR-1255a	HITS-CLIP	23824327
MIRT611887	hsa-miR-1255b-5p	HITS-CLIP	23824327
MIRT611886	hsa-miR-3941	HITS-CLIP	23824327
MIRT611897	hsa-miR-8485	HITS-CLIP	23824327
MIRT611896	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611895	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611894	hsa-miR-603	HITS-CLIP	23824327
MIRT611892	hsa-miR-3186-3p	HITS-CLIP	23824327
MIRT611888	hsa-miR-1255a	HITS-CLIP	23824327
MIRT611887	hsa-miR-1255b-5p	HITS-CLIP	23824327
MIRT611886	hsa-miR-3941	HITS-CLIP	23824327
MIRT611897	hsa-miR-8485	HITS-CLIP	23824327
MIRT611896	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611895	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611894	hsa-miR-603	HITS-CLIP	23824327
MIRT611892	hsa-miR-3186-3p	HITS-CLIP	23824327
MIRT611888	hsa-miR-1255a	HITS-CLIP	23824327
MIRT611887	hsa-miR-1255b-5p	HITS-CLIP	23824327
MIRT611886	hsa-miR-3941	HITS-CLIP	23824327
MIRT611897	hsa-miR-8485	HITS-CLIP	23824327
MIRT611896	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611895	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611894	hsa-miR-603	HITS-CLIP	23824327
MIRT611893	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT635764	hsa-miR-4643	HITS-CLIP	23824327
MIRT611892	hsa-miR-3186-3p	HITS-CLIP	23824327
MIRT611888	hsa-miR-1255a	HITS-CLIP	23824327
MIRT611887	hsa-miR-1255b-5p	HITS-CLIP	23824327
MIRT611886	hsa-miR-3941	HITS-CLIP	23824327
MIRT635763	hsa-miR-466	HITS-CLIP	23824327
MIRT611897	hsa-miR-8485	HITS-CLIP	23824327
MIRT611896	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611895	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611894	hsa-miR-603	HITS-CLIP	23824327
MIRT611893	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT611892	hsa-miR-3186-3p	HITS-CLIP	23824327
MIRT611888	hsa-miR-1255a	HITS-CLIP	23824327
MIRT611887	hsa-miR-1255b-5p	HITS-CLIP	23824327
MIRT611886	hsa-miR-3941	HITS-CLIP	23824327
MIRT611897	hsa-miR-8485	HITS-CLIP	23824327
MIRT611896	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611895	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611894	hsa-miR-603	HITS-CLIP	23824327
MIRT611893	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT611892	hsa-miR-3186-3p	HITS-CLIP	23824327
MIRT611888	hsa-miR-1255a	HITS-CLIP	23824327
MIRT611887	hsa-miR-1255b-5p	HITS-CLIP	23824327
MIRT611886	hsa-miR-3941	HITS-CLIP	23824327
MIRT611897	hsa-miR-8485	HITS-CLIP	23824327
MIRT611896	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611895	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611894	hsa-miR-603	HITS-CLIP	23824327
MIRT611893	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT611892	hsa-miR-3186-3p	HITS-CLIP	23824327
MIRT611888	hsa-miR-1255a	HITS-CLIP	23824327
MIRT611887	hsa-miR-1255b-5p	HITS-CLIP	23824327
MIRT611886	hsa-miR-3941	HITS-CLIP	23824327
MIRT611897	hsa-miR-8485	HITS-CLIP	23824327
MIRT611896	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611895	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611894	hsa-miR-603	HITS-CLIP	23824327
MIRT611893	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT611892	hsa-miR-3186-3p	HITS-CLIP	23824327
MIRT611888	hsa-miR-1255a	HITS-CLIP	23824327
MIRT611887	hsa-miR-1255b-5p	HITS-CLIP	23824327
MIRT611886	hsa-miR-3941	HITS-CLIP	23824327
MIRT611897	hsa-miR-8485	HITS-CLIP	23824327
MIRT611896	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611895	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611894	hsa-miR-603	HITS-CLIP	23824327
MIRT611893	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT611892	hsa-miR-3186-3p	HITS-CLIP	23824327
MIRT611888	hsa-miR-1255a	HITS-CLIP	23824327
MIRT611887	hsa-miR-1255b-5p	HITS-CLIP	23824327
MIRT611886	hsa-miR-3941	HITS-CLIP	23824327
MIRT611897	hsa-miR-8485	HITS-CLIP	23824327
MIRT611896	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611895	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611894	hsa-miR-603	HITS-CLIP	23824327
MIRT611893	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT611892	hsa-miR-3186-3p	HITS-CLIP	23824327
MIRT611891	hsa-miR-3975	HITS-CLIP	23824327
MIRT611890	hsa-miR-2467-5p	HITS-CLIP	23824327
MIRT149142	hsa-miR-485-5p	HITS-CLIP	23824327
MIRT149176	hsa-miR-6884-5p	HITS-CLIP	23824327
MIRT611889	hsa-miR-3188	HITS-CLIP	23824327
MIRT611888	hsa-miR-1255a	HITS-CLIP	23824327
MIRT611887	hsa-miR-1255b-5p	HITS-CLIP	23824327
MIRT611886	hsa-miR-3941	HITS-CLIP	23824327
MIRT611897	hsa-miR-8485	HITS-CLIP	23824327
MIRT611896	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611895	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611894	hsa-miR-603	HITS-CLIP	23824327
MIRT611893	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT611892	hsa-miR-3186-3p	HITS-CLIP	23824327
MIRT611888	hsa-miR-1255a	HITS-CLIP	23824327
MIRT611887	hsa-miR-1255b-5p	HITS-CLIP	23824327
MIRT611886	hsa-miR-3941	HITS-CLIP	23824327
MIRT611897	hsa-miR-8485	HITS-CLIP	23824327
MIRT611896	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611895	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611894	hsa-miR-603	HITS-CLIP	23824327
MIRT611893	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT611892	hsa-miR-3186-3p	HITS-CLIP	23824327
MIRT611891	hsa-miR-3975	HITS-CLIP	23824327
MIRT611890	hsa-miR-2467-5p	HITS-CLIP	23824327
MIRT149142	hsa-miR-485-5p	HITS-CLIP	23824327
MIRT149176	hsa-miR-6884-5p	HITS-CLIP	23824327
MIRT611889	hsa-miR-3188	HITS-CLIP	23824327
MIRT611888	hsa-miR-1255a	HITS-CLIP	23824327
MIRT611887	hsa-miR-1255b-5p	HITS-CLIP	23824327
MIRT611886	hsa-miR-3941	HITS-CLIP	23824327
MIRT727476	hsa-miR-92a-3p	HITS-CLIP	22473208
MIRT727474	hsa-miR-92b-3p	HITS-CLIP	22473208
MIRT727475	hsa-miR-32-5p	HITS-CLIP	22473208
MIRT004020	hsa-miR-17-3p	Luciferase reporter assay	26935986
MIRT004020	hsa-miR-17-3p	Luciferase reporter assay	26935986
MIRT004020	hsa-miR-17-3p	Luciferase reporter assayWestern blot	26935986
MIRT004020	hsa-miR-17-3p	Luciferase reporter assayWestern blot	26935986
MIRT004430	hsa-miR-221-3p	Luciferase reporter assay	28338009
MIRT004595	hsa-miR-222-3p	Luciferase reporter assay	28338009
MIRT734212	hsa-miR-223-3p	ELISAFlow cytometryImmunofluorescenceLuciferase reporter assayqRT-PCRWestern blotting	33637123
MIRT736710	hsa-miR-29a-3p	Luciferase reporter assayWestern blottingqRT-PCR	31538414
MIRT611897	hsa-miR-8485	HITS-CLIP	19536157
MIRT611896	hsa-miR-329-3p	HITS-CLIP	19536157
MIRT611895	hsa-miR-362-3p	HITS-CLIP	19536157
MIRT611894	hsa-miR-603	HITS-CLIP	19536157
MIRT611892	hsa-miR-3186-3p	HITS-CLIP	19536157
MIRT611888	hsa-miR-1255a	HITS-CLIP	19536157
MIRT611887	hsa-miR-1255b-5p	HITS-CLIP	19536157
MIRT611886	hsa-miR-3941	HITS-CLIP	19536157
MIRT611897	hsa-miR-8485	HITS-CLIP	23824327
MIRT611896	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611895	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611894	hsa-miR-603	HITS-CLIP	23824327
MIRT611893	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT611892	hsa-miR-3186-3p	HITS-CLIP	23824327
MIRT611891	hsa-miR-3975	HITS-CLIP	23824327
MIRT611890	hsa-miR-2467-5p	HITS-CLIP	23824327
MIRT611889	hsa-miR-3188	HITS-CLIP	23824327
MIRT611888	hsa-miR-1255a	HITS-CLIP	23824327
MIRT611887	hsa-miR-1255b-5p	HITS-CLIP	23824327
MIRT611886	hsa-miR-3941	HITS-CLIP	23824327
MIRT611897	hsa-miR-8485	HITS-CLIP	23824327
MIRT611896	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611895	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611894	hsa-miR-603	HITS-CLIP	23824327
MIRT611893	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT611892	hsa-miR-3186-3p	HITS-CLIP	23824327
MIRT611888	hsa-miR-1255a	HITS-CLIP	23824327
MIRT611887	hsa-miR-1255b-5p	HITS-CLIP	23824327
MIRT611886	hsa-miR-3941	HITS-CLIP	23824327
MIRT611897	hsa-miR-8485	HITS-CLIP	23824327
MIRT611896	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611895	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611894	hsa-miR-603	HITS-CLIP	23824327
MIRT611893	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT611892	hsa-miR-3186-3p	HITS-CLIP	23824327
MIRT611888	hsa-miR-1255a	HITS-CLIP	23824327
MIRT611887	hsa-miR-1255b-5p	HITS-CLIP	23824327
MIRT611886	hsa-miR-3941	HITS-CLIP	23824327
MIRT611897	hsa-miR-8485	HITS-CLIP	23824327
MIRT611896	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611895	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611894	hsa-miR-603	HITS-CLIP	23824327
MIRT611893	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT611892	hsa-miR-3186-3p	HITS-CLIP	23824327
MIRT611888	hsa-miR-1255a	HITS-CLIP	23824327
MIRT611887	hsa-miR-1255b-5p	HITS-CLIP	23824327
MIRT611886	hsa-miR-3941	HITS-CLIP	23824327
MIRT611897	hsa-miR-8485	HITS-CLIP	23824327
MIRT611896	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611895	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611894	hsa-miR-603	HITS-CLIP	23824327
MIRT611892	hsa-miR-3186-3p	HITS-CLIP	23824327
MIRT611888	hsa-miR-1255a	HITS-CLIP	23824327
MIRT611887	hsa-miR-1255b-5p	HITS-CLIP	23824327
MIRT611886	hsa-miR-3941	HITS-CLIP	23824327
MIRT611897	hsa-miR-8485	HITS-CLIP	23824327
MIRT611896	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611895	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611894	hsa-miR-603	HITS-CLIP	23824327
MIRT611892	hsa-miR-3186-3p	HITS-CLIP	23824327
MIRT611888	hsa-miR-1255a	HITS-CLIP	23824327
MIRT611887	hsa-miR-1255b-5p	HITS-CLIP	23824327
MIRT611886	hsa-miR-3941	HITS-CLIP	23824327
MIRT611897	hsa-miR-8485	HITS-CLIP	23824327
MIRT611896	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611895	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611894	hsa-miR-603	HITS-CLIP	23824327
MIRT611893	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT635764	hsa-miR-4643	HITS-CLIP	23824327
MIRT611892	hsa-miR-3186-3p	HITS-CLIP	23824327
MIRT611888	hsa-miR-1255a	HITS-CLIP	23824327
MIRT611887	hsa-miR-1255b-5p	HITS-CLIP	23824327
MIRT611886	hsa-miR-3941	HITS-CLIP	23824327
MIRT635763	hsa-miR-466	HITS-CLIP	23824327
MIRT611897	hsa-miR-8485	HITS-CLIP	23824327
MIRT611896	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611895	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611894	hsa-miR-603	HITS-CLIP	23824327
MIRT611893	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT611892	hsa-miR-3186-3p	HITS-CLIP	23824327
MIRT611888	hsa-miR-1255a	HITS-CLIP	23824327
MIRT611887	hsa-miR-1255b-5p	HITS-CLIP	23824327
MIRT611886	hsa-miR-3941	HITS-CLIP	23824327
MIRT611897	hsa-miR-8485	HITS-CLIP	23824327
MIRT611896	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611895	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611894	hsa-miR-603	HITS-CLIP	23824327
MIRT611893	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT611892	hsa-miR-3186-3p	HITS-CLIP	23824327
MIRT611888	hsa-miR-1255a	HITS-CLIP	23824327
MIRT611887	hsa-miR-1255b-5p	HITS-CLIP	23824327
MIRT611886	hsa-miR-3941	HITS-CLIP	23824327
MIRT611897	hsa-miR-8485	HITS-CLIP	23824327
MIRT611896	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611895	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611894	hsa-miR-603	HITS-CLIP	23824327
MIRT611893	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT611892	hsa-miR-3186-3p	HITS-CLIP	23824327
MIRT611888	hsa-miR-1255a	HITS-CLIP	23824327
MIRT611887	hsa-miR-1255b-5p	HITS-CLIP	23824327
MIRT611886	hsa-miR-3941	HITS-CLIP	23824327
MIRT611897	hsa-miR-8485	HITS-CLIP	23824327
MIRT611896	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611895	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611894	hsa-miR-603	HITS-CLIP	23824327
MIRT611893	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT611892	hsa-miR-3186-3p	HITS-CLIP	23824327
MIRT611888	hsa-miR-1255a	HITS-CLIP	23824327
MIRT611887	hsa-miR-1255b-5p	HITS-CLIP	23824327
MIRT611886	hsa-miR-3941	HITS-CLIP	23824327
MIRT611897	hsa-miR-8485	HITS-CLIP	23824327
MIRT611896	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611895	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611894	hsa-miR-603	HITS-CLIP	23824327
MIRT611893	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT611892	hsa-miR-3186-3p	HITS-CLIP	23824327
MIRT611888	hsa-miR-1255a	HITS-CLIP	23824327
MIRT611887	hsa-miR-1255b-5p	HITS-CLIP	23824327
MIRT611886	hsa-miR-3941	HITS-CLIP	23824327
MIRT611897	hsa-miR-8485	HITS-CLIP	23824327
MIRT611896	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611895	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611894	hsa-miR-603	HITS-CLIP	23824327
MIRT611893	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT611892	hsa-miR-3186-3p	HITS-CLIP	23824327
MIRT611891	hsa-miR-3975	HITS-CLIP	23824327
MIRT611890	hsa-miR-2467-5p	HITS-CLIP	23824327
MIRT149142	hsa-miR-485-5p	HITS-CLIP	23824327
MIRT149176	hsa-miR-6884-5p	HITS-CLIP	23824327
MIRT611889	hsa-miR-3188	HITS-CLIP	23824327
MIRT611888	hsa-miR-1255a	HITS-CLIP	23824327
MIRT611887	hsa-miR-1255b-5p	HITS-CLIP	23824327
MIRT611886	hsa-miR-3941	HITS-CLIP	23824327
MIRT611897	hsa-miR-8485	HITS-CLIP	23824327
MIRT611896	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611895	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611894	hsa-miR-603	HITS-CLIP	23824327
MIRT611893	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT611892	hsa-miR-3186-3p	HITS-CLIP	23824327
MIRT611888	hsa-miR-1255a	HITS-CLIP	23824327
MIRT611887	hsa-miR-1255b-5p	HITS-CLIP	23824327
MIRT611886	hsa-miR-3941	HITS-CLIP	23824327
MIRT611897	hsa-miR-8485	HITS-CLIP	23824327
MIRT611896	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611895	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611894	hsa-miR-603	HITS-CLIP	23824327
MIRT611893	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT611892	hsa-miR-3186-3p	HITS-CLIP	23824327
MIRT611891	hsa-miR-3975	HITS-CLIP	23824327
MIRT611890	hsa-miR-2467-5p	HITS-CLIP	23824327
MIRT149142	hsa-miR-485-5p	HITS-CLIP	23824327
MIRT149176	hsa-miR-6884-5p	HITS-CLIP	23824327
MIRT611889	hsa-miR-3188	HITS-CLIP	23824327
MIRT611888	hsa-miR-1255a	HITS-CLIP	23824327
MIRT611887	hsa-miR-1255b-5p	HITS-CLIP	23824327
MIRT611886	hsa-miR-3941	HITS-CLIP	23824327
MIRT755509	hsa-miR-26a-5p	qRT-PCR	35681518
MIRT755531	hsa-miR-149-3p	qRT-PCR	36250208
MIRT1058518	hsa-miR-1225-3p	CLIP-seq
MIRT1058519	hsa-miR-1233	CLIP-seq
MIRT1058520	hsa-miR-1237	CLIP-seq
MIRT1058521	hsa-miR-1248	CLIP-seq
MIRT1058522	hsa-miR-1255b	CLIP-seq
MIRT1058523	hsa-miR-1262	CLIP-seq
MIRT1058524	hsa-miR-2110	CLIP-seq
MIRT1058525	hsa-miR-2355-5p	CLIP-seq
MIRT1058526	hsa-miR-25	CLIP-seq
MIRT1058527	hsa-miR-3127-3p	CLIP-seq
MIRT1058528	hsa-miR-3153	CLIP-seq
MIRT1058529	hsa-miR-32	CLIP-seq
MIRT1058530	hsa-miR-3200-3p	CLIP-seq
MIRT1058531	hsa-miR-328	CLIP-seq
MIRT1058532	hsa-miR-329	CLIP-seq
MIRT1058533	hsa-miR-34b	CLIP-seq
MIRT1058534	hsa-miR-3614-5p	CLIP-seq
MIRT1058535	hsa-miR-363	CLIP-seq
MIRT1058536	hsa-miR-3664-3p	CLIP-seq
MIRT1058537	hsa-miR-367	CLIP-seq
MIRT1058538	hsa-miR-3689a-3p	CLIP-seq
MIRT1058539	hsa-miR-3689c	CLIP-seq
MIRT1058540	hsa-miR-3929	CLIP-seq
MIRT1058541	hsa-miR-4271	CLIP-seq
MIRT1058542	hsa-miR-4281	CLIP-seq
MIRT1058543	hsa-miR-4286	CLIP-seq
MIRT1058544	hsa-miR-4299	CLIP-seq
MIRT1058545	hsa-miR-4313	CLIP-seq
MIRT1058546	hsa-miR-4314	CLIP-seq
MIRT1058547	hsa-miR-4419b	CLIP-seq
MIRT1058548	hsa-miR-4433	CLIP-seq
MIRT1058549	hsa-miR-4459	CLIP-seq
MIRT1058550	hsa-miR-4478	CLIP-seq
MIRT1058551	hsa-miR-4667-5p	CLIP-seq
MIRT1058552	hsa-miR-4695-5p	CLIP-seq
MIRT1058553	hsa-miR-4700-5p	CLIP-seq
MIRT1058554	hsa-miR-4701-3p	CLIP-seq
MIRT1058555	hsa-miR-4725-3p	CLIP-seq
MIRT1058556	hsa-miR-4728-5p	CLIP-seq
MIRT1058557	hsa-miR-4768-3p	CLIP-seq
MIRT1058558	hsa-miR-4793-3p	CLIP-seq
MIRT1058559	hsa-miR-483-3p	CLIP-seq
MIRT1058560	hsa-miR-508-5p	CLIP-seq
MIRT1058561	hsa-miR-510	CLIP-seq
MIRT1058562	hsa-miR-512-5p	CLIP-seq
MIRT1058563	hsa-miR-542-3p	CLIP-seq
MIRT1058564	hsa-miR-548c-3p	CLIP-seq
MIRT1058565	hsa-miR-619	CLIP-seq
MIRT1058566	hsa-miR-637	CLIP-seq
MIRT1058567	hsa-miR-661	CLIP-seq
MIRT1058568	hsa-miR-766	CLIP-seq
MIRT1058569	hsa-miR-767-5p	CLIP-seq
MIRT1058570	hsa-miR-92a	CLIP-seq
MIRT1058571	hsa-miR-92b	CLIP-seq
MIRT1058526	hsa-miR-25	CLIP-seq
MIRT1058529	hsa-miR-32	CLIP-seq
MIRT1058534	hsa-miR-3614-5p	CLIP-seq
MIRT1058535	hsa-miR-363	CLIP-seq
MIRT1058536	hsa-miR-3664-3p	CLIP-seq
MIRT1058537	hsa-miR-367	CLIP-seq
MIRT1058538	hsa-miR-3689a-3p	CLIP-seq
MIRT1058539	hsa-miR-3689c	CLIP-seq
MIRT1058540	hsa-miR-3929	CLIP-seq
MIRT1058542	hsa-miR-4281	CLIP-seq
MIRT1058547	hsa-miR-4419b	CLIP-seq
MIRT1058548	hsa-miR-4433	CLIP-seq
MIRT1058549	hsa-miR-4459	CLIP-seq
MIRT1058550	hsa-miR-4478	CLIP-seq
MIRT1058552	hsa-miR-4695-5p	CLIP-seq
MIRT1058556	hsa-miR-4728-5p	CLIP-seq
MIRT1058557	hsa-miR-4768-3p	CLIP-seq
MIRT1058561	hsa-miR-510	CLIP-seq
MIRT1058562	hsa-miR-512-5p	CLIP-seq
MIRT1058569	hsa-miR-767-5p	CLIP-seq
MIRT1058570	hsa-miR-92a	CLIP-seq
MIRT1058571	hsa-miR-92b	CLIP-seq
MIRT1058518	hsa-miR-1225-3p	CLIP-seq
MIRT1058519	hsa-miR-1233	CLIP-seq
MIRT1058534	hsa-miR-3614-5p	CLIP-seq
MIRT1058536	hsa-miR-3664-3p	CLIP-seq
MIRT1058538	hsa-miR-3689a-3p	CLIP-seq
MIRT1058539	hsa-miR-3689c	CLIP-seq
MIRT1058540	hsa-miR-3929	CLIP-seq
MIRT1058542	hsa-miR-4281	CLIP-seq
MIRT1058547	hsa-miR-4419b	CLIP-seq
MIRT1058548	hsa-miR-4433	CLIP-seq
MIRT1058549	hsa-miR-4459	CLIP-seq
MIRT1058550	hsa-miR-4478	CLIP-seq
MIRT1058552	hsa-miR-4695-5p	CLIP-seq
MIRT1058556	hsa-miR-4728-5p	CLIP-seq
MIRT1058557	hsa-miR-4768-3p	CLIP-seq
MIRT1058561	hsa-miR-510	CLIP-seq
MIRT1058562	hsa-miR-512-5p	CLIP-seq
MIRT1058518	hsa-miR-1225-3p	CLIP-seq
MIRT1058519	hsa-miR-1233	CLIP-seq
MIRT1058534	hsa-miR-3614-5p	CLIP-seq
MIRT1058536	hsa-miR-3664-3p	CLIP-seq
MIRT1058538	hsa-miR-3689a-3p	CLIP-seq
MIRT1058539	hsa-miR-3689c	CLIP-seq
MIRT1058540	hsa-miR-3929	CLIP-seq
MIRT1058542	hsa-miR-4281	CLIP-seq
MIRT1058547	hsa-miR-4419b	CLIP-seq
MIRT1058548	hsa-miR-4433	CLIP-seq
MIRT1058549	hsa-miR-4459	CLIP-seq
MIRT1058550	hsa-miR-4478	CLIP-seq
MIRT1058552	hsa-miR-4695-5p	CLIP-seq
MIRT1058556	hsa-miR-4728-5p	CLIP-seq
MIRT1058557	hsa-miR-4768-3p	CLIP-seq
MIRT1058561	hsa-miR-510	CLIP-seq
MIRT1058562	hsa-miR-512-5p	CLIP-seq
MIRT2429716	hsa-miR-1285	CLIP-seq
MIRT2429717	hsa-miR-1299	CLIP-seq
MIRT2429718	hsa-miR-130a	CLIP-seq
MIRT2429719	hsa-miR-130b	CLIP-seq
MIRT2429720	hsa-miR-203	CLIP-seq
MIRT2429721	hsa-miR-301a	CLIP-seq
MIRT2429722	hsa-miR-301b	CLIP-seq
MIRT2429723	hsa-miR-3148	CLIP-seq
MIRT2429724	hsa-miR-3187-5p	CLIP-seq
MIRT2429725	hsa-miR-326	CLIP-seq
MIRT2429726	hsa-miR-330-5p	CLIP-seq
MIRT2429727	hsa-miR-3666	CLIP-seq
MIRT2429728	hsa-miR-378g	CLIP-seq
MIRT2429729	hsa-miR-3910	CLIP-seq
MIRT2429730	hsa-miR-3945	CLIP-seq
MIRT2429731	hsa-miR-409-3p	CLIP-seq
MIRT2429732	hsa-miR-4253	CLIP-seq
MIRT2429733	hsa-miR-4295	CLIP-seq
MIRT2429734	hsa-miR-4436a	CLIP-seq
MIRT2429735	hsa-miR-4453	CLIP-seq
MIRT2429736	hsa-miR-4486	CLIP-seq
MIRT2429737	hsa-miR-4538	CLIP-seq
MIRT2429738	hsa-miR-454	CLIP-seq
MIRT2429739	hsa-miR-4671-3p	CLIP-seq
MIRT2429740	hsa-miR-4700-3p	CLIP-seq
MIRT2429741	hsa-miR-4737	CLIP-seq
MIRT2429742	hsa-miR-593	CLIP-seq
MIRT2429743	hsa-miR-612	CLIP-seq
MIRT2429744	hsa-miR-635	CLIP-seq
MIRT2429745	hsa-miR-875-3p	CLIP-seq
MIRT2437675	hsa-miR-2861	CLIP-seq
MIRT2437676	hsa-miR-4265	CLIP-seq
MIRT2437677	hsa-miR-4296	CLIP-seq
MIRT2437678	hsa-miR-4322	CLIP-seq
MIRT2437679	hsa-miR-4417	CLIP-seq
MIRT2437680	hsa-miR-4800-3p	CLIP-seq
MIRT2437681	hsa-miR-595	CLIP-seq
MIRT2437682	hsa-miR-873	CLIP-seq
MIRT2437675	hsa-miR-2861	CLIP-seq
MIRT2437676	hsa-miR-4265	CLIP-seq
MIRT2437677	hsa-miR-4296	CLIP-seq
MIRT2437678	hsa-miR-4322	CLIP-seq
MIRT2437679	hsa-miR-4417	CLIP-seq
MIRT2437680	hsa-miR-4800-3p	CLIP-seq
MIRT2437681	hsa-miR-595	CLIP-seq
MIRT2442261	hsa-miR-599	CLIP-seq
MIRT2437682	hsa-miR-873	CLIP-seq
MIRT2548894	hsa-miR-1205	CLIP-seq
MIRT1058522	hsa-miR-1255b	CLIP-seq
MIRT2429716	hsa-miR-1285	CLIP-seq
MIRT2548895	hsa-miR-1286	CLIP-seq
MIRT2548896	hsa-miR-1289	CLIP-seq
MIRT2548897	hsa-miR-1291	CLIP-seq
MIRT2429717	hsa-miR-1299	CLIP-seq
MIRT2429718	hsa-miR-130a	CLIP-seq
MIRT2429719	hsa-miR-130b	CLIP-seq
MIRT2548898	hsa-miR-146b-3p	CLIP-seq
MIRT2548899	hsa-miR-153	CLIP-seq
MIRT2548900	hsa-miR-2115	CLIP-seq
MIRT1058525	hsa-miR-2355-5p	CLIP-seq
MIRT2429721	hsa-miR-301a	CLIP-seq
MIRT2429722	hsa-miR-301b	CLIP-seq
MIRT1058527	hsa-miR-3127-3p	CLIP-seq
MIRT2429723	hsa-miR-3148	CLIP-seq
MIRT2429724	hsa-miR-3187-5p	CLIP-seq
MIRT2548901	hsa-miR-3192	CLIP-seq
MIRT1058530	hsa-miR-3200-3p	CLIP-seq
MIRT2548902	hsa-miR-320a	CLIP-seq
MIRT2548903	hsa-miR-320b	CLIP-seq
MIRT2548904	hsa-miR-320c	CLIP-seq
MIRT2548905	hsa-miR-320d	CLIP-seq
MIRT2548906	hsa-miR-320e	CLIP-seq
MIRT2548907	hsa-miR-323b-3p	CLIP-seq
MIRT2429725	hsa-miR-326	CLIP-seq
MIRT1058531	hsa-miR-328	CLIP-seq
MIRT2429726	hsa-miR-330-5p	CLIP-seq
MIRT2429727	hsa-miR-3666	CLIP-seq
MIRT1058538	hsa-miR-3689a-3p	CLIP-seq
MIRT1058539	hsa-miR-3689c	CLIP-seq
MIRT2429728	hsa-miR-378g	CLIP-seq
MIRT2429731	hsa-miR-409-3p	CLIP-seq
MIRT1058543	hsa-miR-4286	CLIP-seq
MIRT2429733	hsa-miR-4295	CLIP-seq
MIRT1058545	hsa-miR-4313	CLIP-seq
MIRT2548908	hsa-miR-4327	CLIP-seq
MIRT2548909	hsa-miR-4418	CLIP-seq
MIRT2548910	hsa-miR-4419a	CLIP-seq
MIRT2548911	hsa-miR-4429	CLIP-seq
MIRT2548912	hsa-miR-4449	CLIP-seq
MIRT2429736	hsa-miR-4486	CLIP-seq
MIRT2548913	hsa-miR-4493	CLIP-seq
MIRT2548914	hsa-miR-4496	CLIP-seq
MIRT2548915	hsa-miR-4510	CLIP-seq
MIRT2548916	hsa-miR-4532	CLIP-seq
MIRT2429738	hsa-miR-454	CLIP-seq
MIRT2548917	hsa-miR-4633-3p	CLIP-seq
MIRT2429739	hsa-miR-4671-3p	CLIP-seq
MIRT2548918	hsa-miR-4691-5p	CLIP-seq
MIRT2548919	hsa-miR-4715-3p	CLIP-seq
MIRT2548920	hsa-miR-4722-5p	CLIP-seq
MIRT2548921	hsa-miR-4725-5p	CLIP-seq
MIRT1058556	hsa-miR-4728-5p	CLIP-seq
MIRT2429741	hsa-miR-4737	CLIP-seq
MIRT2548922	hsa-miR-4738-3p	CLIP-seq
MIRT2548923	hsa-miR-4747-5p	CLIP-seq
MIRT2548924	hsa-miR-504	CLIP-seq
MIRT2548925	hsa-miR-509-3-5p	CLIP-seq
MIRT2548926	hsa-miR-509-5p	CLIP-seq
MIRT2548927	hsa-miR-558	CLIP-seq
MIRT2429742	hsa-miR-593	CLIP-seq
MIRT2429743	hsa-miR-612	CLIP-seq
MIRT2429745	hsa-miR-875-3p	CLIP-seq
MIRT2548897	hsa-miR-1291	CLIP-seq
MIRT2429717	hsa-miR-1299	CLIP-seq
MIRT2548898	hsa-miR-146b-3p	CLIP-seq
MIRT2429725	hsa-miR-326	CLIP-seq
MIRT2429726	hsa-miR-330-5p	CLIP-seq
MIRT2429731	hsa-miR-409-3p	CLIP-seq
MIRT2548912	hsa-miR-4449	CLIP-seq
MIRT2548913	hsa-miR-4493	CLIP-seq
MIRT2548916	hsa-miR-4532	CLIP-seq
MIRT2548919	hsa-miR-4715-3p	CLIP-seq
MIRT2429741	hsa-miR-4737	CLIP-seq
MIRT2548923	hsa-miR-4747-5p	CLIP-seq
MIRT2429742	hsa-miR-593	CLIP-seq
MIRT2429745	hsa-miR-875-3p	CLIP-seq

Show/Hide all (23)

Transcription factor	Regulation	Reference
CEBPA	Unknown	9916895
ERG	Repression	22235125
ETS2	Activation	9572487
ETV5	Activation	9572487
HDAC1	Activation	12490396
IFI16	Repression	17699163
MYB	Repression	21953443
NFATC1	Activation	19351910
NFKB1	Activation	10092659;10946302;11463837;11877286;16317091;16385502;17121934;19074768;20173029;22001597;22708120;9733827;9916895
NFKB1	Unknown	10738944;10837365;10926553;11198351;11401521;12490396;12691701;15480988;15800027;15843586;16105834;16453001;18285351;18928584;20103608;9192770
NFKBIA	Repression	12490396;9733827;9990039
PPARG	Repression	17425601
RARA	Activation	1355009
RARG	Activation	1355009
REL	Unknown	10706725;10837365;10926553
RELA	Activation	10092659;10946302;11463837;11877286;16317091;16385502;17121934;19074768;19351910;20173029;22001597;22708120;9733827;9888295;9916895
RELA	Unknown	10228026;10837365;10926553;11401521;12490396;12691701;15800027;15843586;16105834;16453001;18285351;18928584;20103608;9192770
SIRT1	Repression	23238746
SP1	Unknown	15480988
STAT1	Activation	12651068;9888295;9990314
STAT3	Unknown	23690481;8675499
TWIST1	Activation	17487558
TWIST2	Activation	17487558

Show/Hide all (54)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001618	Function	Virus receptor activity	IEA
GO:0001772	Component	Immunological synapse	IEA
GO:0001910	Process	Regulation of leukocyte mediated cytotoxicity	TAS	16038038
GO:0002252	Process	Immune effector process	IEA
GO:0002291	Process	T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell	IMP	2477710
GO:0002457	Process	T cell antigen processing and presentation	IEA
GO:0002693	Process	Positive regulation of cellular extravasation	IMP	12902516
GO:0004888	Function	Transmembrane signaling receptor activity	TAS	2538243
GO:0005178	Function	Integrin binding	IBA
GO:0005178	Function	Integrin binding	IDA	23620790
GO:0005178	Function	Integrin binding	IEA
GO:0005178	Function	Integrin binding	IPI	1448173, 12208882
GO:0005515	Function	Protein binding	IPI	7822297, 12526797, 12716892, 16595626, 22956999, 23858057, 28514442, 32296183, 32814053, 33961781
GO:0005615	Component	Extracellular space	IDA	9290466
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	NAS	3349522
GO:0005886	Component	Plasma membrane	TAS	2538243
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0006955	Process	Immune response	IEA
GO:0007155	Process	Cell adhesion	IBA
GO:0007155	Process	Cell adhesion	IDA	16809613
GO:0007155	Process	Cell adhesion	IEA
GO:0007155	Process	Cell adhesion	IEA
GO:0007157	Process	Heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	TAS	2477710
GO:0007159	Process	Leukocyte cell-cell adhesion	IEA
GO:0007159	Process	Leukocyte cell-cell adhesion	IEA
GO:0007159	Process	Leukocyte cell-cell adhesion	IMP	2477710
GO:0009897	Component	External side of plasma membrane	IEA
GO:0009986	Component	Cell surface	HDA	19581412, 23981064
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0022614	Process	Membrane to membrane docking	IEP	12082081
GO:0031012	Component	Extracellular matrix	HDA	27559042
GO:0033627	Process	Cell adhesion mediated by integrin	IEA
GO:0038023	Function	Signaling receptor activity	TAS	2538243
GO:0044406	Process	Adhesion of symbiont to host	IDA	2538243
GO:0045121	Component	Membrane raft	IEA
GO:0046718	Process	Symbiont entry into host cell	IEA
GO:0046813	Process	Receptor-mediated virion attachment to host cell	IDA	2538243
GO:0050900	Process	Leukocyte migration	IEA
GO:0050900	Process	Leukocyte migration	IEP	12082081
GO:0061028	Process	Establishment of endothelial barrier	IGI	23264465
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337
GO:0070062	Component	Extracellular exosome	IDA	21276792
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IMP	10903502
GO:0071333	Process	Cellular response to glucose stimulus	IEA
GO:0072683	Process	T cell extravasation	IEA
GO:0098609	Process	Cell-cell adhesion	IEA
GO:1900027	Process	Regulation of ruffle assembly	IEA
GO:1901701	Process	Cellular response to oxygen-containing compound	IEA
GO:1902042	Process	Negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	IDA	10903502
GO:1904646	Process	Cellular response to amyloid-beta	IDA	11078691
GO:1990830	Process	Cellular response to leukemia inhibitory factor	IEA
GO:2000352	Process	Negative regulation of endothelial cell apoptotic process	IDA	10903502

MIM	HGNC	e!Ensembl
147840	5344	ENSG00000090339

P05362

Protein name

Intercellular adhesion molecule 1 (ICAM-1) (Major group rhinovirus receptor) (CD antigen CD54)

Protein function

ICAM proteins are ligands for the leukocyte adhesion protein LFA-1 (integrin alpha-L/beta-2). During leukocyte trans-endothelial migration, ICAM1 engagement promotes the assembly of endothelial apical cups through ARHGEF26/SGEF and RHOG activati

PDB

1D3E , 1D3I , 1D3L , 1IAM , 1IC1 , 1MQ8 , 1P53 , 1Z7Z , 2OZ4 , 3TCX , 5MZA , 6EIT , 6S8U , 7BG7

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03921	ICAM_N	24 → 115	Intercellular adhesion molecule (ICAM), N-terminal domain	Domain

Sequence

MAPSSPRPALPALLVLLGALFPGPGNAQTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGI
ETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAP
LPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHH
GANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLD
GLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQE
TLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKA
TPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQ
AWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYE
IVIITVVAAAVIMGTAGLSTYLYNRQRKIKKYRLQQAQKGTPMKPNTQATPP

Sequence length

532

Interactions

View interactions

	KEGG		Reactome
	NF-kappa B signaling pathway Cell adhesion molecules Natural killer cell mediated cytotoxicity TNF signaling pathway Leukocyte transendothelial migration AGE-RAGE signaling pathway in diabetic complications African trypanosomiasis Malaria Staphylococcus aureus infection Influenza A Human T-cell leukemia virus 1 infection Kaposi sarcoma-associated herpesvirus infection Epstein-Barr virus infection Rheumatoid arthritis Viral myocarditis Lipid and atherosclerosis Fluid shear stress and atherosclerosis		Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell Integrin cell surface interactions Interleukin-10 signaling Interleukin-4 and Interleukin-13 signaling Interferon gamma signaling

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
ICAM1-related disorder	Likely benign; Benign; risk factor	rs376045646, rs5491, rs1799969, rs35956512, rs548184831, rs5490, rs5498, rs5030381, rs146134321, rs150121537	RCV003966381 RCV003914847 RCV003977378 RCV003951990 RCV003944367 RCV003979302 RCV003982106 RCV003968114 RCV003930661 RCV003957930
Malaria, cerebral, susceptibility to	Benign; risk factor	rs5491	RCV000015768
Malaria, susceptibility to	Uncertain significance; Conflicting classifications of pathogenicity	rs1225105373, rs753646159, rs747111380, rs5030400	RCV002208748 RCV002204529 RCV003224689 RCV001027828

Show/Hide Text Mining Associations (572)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
ABCD syndrome	Associate	39182041
Abnormalities Drug Induced	Associate	10540181
Abortion Habitual	Associate	27929073
Achondroplasia	Stimulate	12823344
Acidosis	Stimulate	22110680
Acne Vulgaris	Associate	31281837
Acquired Immunodeficiency Syndrome	Stimulate	7909296
Acrocephalosyndactylia	Associate	24083591
Actinic Prurigo	Associate	15191561
Acute Coronary Syndrome	Associate	24452942
Acute On Chronic Liver Failure	Inhibit	38111573
Adenocarcinoma	Associate	22014341, 27363029, 34818353
Adenocarcinoma of Lung	Associate	30278450, 30606988, 32373966, 33480074, 35630550, 35806134, 38204755
Alexander Disease	Associate	9797554
Alopecia Areata	Associate	8721483
Alveolitis Extrinsic Allergic	Associate	7554406
Alzheimer Disease	Stimulate	20110602, 33720880
Alzheimer Disease	Associate	21942811, 22272623, 25197660, 29343717, 38167125, 38178159, 7904796
Anaplasia	Associate	25178329
Anemia Sickle Cell	Stimulate	10807794, 24551209
Anemia Sickle Cell	Associate	12034693, 32777069, 9371854
Angina Pectoris	Associate	26078712
Angina Stable	Inhibit	10475771
Angina Stable	Stimulate	37298547
Angina Unstable	Associate	10475771, 15704532, 15757077, 20940515
Anthropophobia	Stimulate	34831335
Anti Neutrophil Cytoplasmic Antibody Associated Vasculitis	Associate	33957974
Anti Neutrophil Cytoplasmic Antibody Associated Vasculitis	Stimulate	9844062
Antiphospholipid Syndrome	Associate	37014642
Antiphospholipid Syndrome	Stimulate	37914735
Aortic Aneurysm	Associate	7955542
Aortic Aneurysm Abdominal	Associate	11854734, 12928630, 7955542
Arterial Occlusive Diseases	Stimulate	11854734
Arteritis	Stimulate	1712368
Arthritis	Associate	12808331
Arthritis Psoriatic	Associate	11310827, 1702929, 31864394
Arthritis Rheumatoid	Associate	10447928, 11083275, 12417058, 12632416, 12746897, 1352152, 15756053, 16385502, 17009243, 17359498, 19597294, 23632129, 30071898, 31652652, 31812161, 32674360, 8536370, 9099936, 9691097 View all (4 more)
Arthritis Rheumatoid	Inhibit	12296865
Arthritis Rheumatoid	Stimulate	33424834, 37958839, 39379962
Ascites	Stimulate	33270665
Ascites	Associate	33921783
Asthma	Associate	10092659, 10885418, 18446055, 25003170, 30339462, 32348692, 33122732, 36197221, 7512004, 7525343, 7545095, 9625753
Asthma	Inhibit	38373824
Astrocytoma	Associate	19357230
Astrocytoma	Stimulate	24252689
Atherosclerosis	Associate	10892347, 11805151, 15704532, 17089918, 18057581, 18420209, 19332210, 20360547, 20940515, 21496279, 22648254, 24942509, 25003524, 25310099, 26078712 View all (12 more)
Atherosclerosis	Stimulate	1372160, 15711569
Atrial Fibrillation	Associate	18375832
Atrophy	Associate	11737595
Atypical Squamous Cells of the Cervix	Associate	8102029
Autism Spectrum Disorder	Associate	39481220
Autoimmune Diseases	Associate	17112530, 27706780, 7526029, 7705360, 7903279, 8721479
Autoimmune enteropathy	Stimulate	1361864
Azoospermia	Associate	30704307
Barrett Esophagus	Associate	24474251
Barrett Esophagus	Stimulate	27363029
Behcet Syndrome	Stimulate	10333719, 17056573
Behcet Syndrome	Associate	12808331, 24136464
Bile Duct Diseases	Associate	14606706
Biliary Atresia	Associate	7519822, 9149337
Bone Diseases	Associate	15287939
Bone Marrow Diseases	Associate	34503477
Bone Marrow Diseases	Stimulate	34879826
Bone Resorption	Associate	11028443
Brain Diseases	Associate	31849969
Brain Ischemia	Associate	10898423, 15067196
Brain Neoplasms	Associate	24289603
Breast Neoplasms	Associate	10880401, 20459645, 21590495, 22791584, 23337791, 24566270, 25202046, 26299331, 28367091, 29498809, 30082828, 36373309, 36788602, 40230289
Breast Neoplasms	Inhibit	11761443
Bronchiectasis	Associate	11106214, 17931847
Burkitt Lymphoma	Associate	1691936, 27655016
Burkitt Lymphoma	Inhibit	2898508
Burkitt Lymphoma	Stimulate	9763568
Calcinosis Cutis	Associate	17607380, 9514061
Candidiasis Vulvovaginal	Associate	28920516
Carcinogenesis	Associate	22562265, 24069166, 24789429, 26265203, 32466535, 33462208, 35887223
Carcinogenesis	Stimulate	35473775
Carcinoma Basal Cell	Associate	21980389, 22664550, 24789429
Carcinoma Hepatocellular	Associate	15053044, 24614035, 26109813, 26341495, 33462208, 34696675, 34869770, 7927492
Carcinoma Hepatocellular	Stimulate	35473775
Carcinoma Medullary	Associate	7992839
Carcinoma Merkel Cell	Associate	29808366
Carcinoma Non Small Cell Lung	Associate	15053044, 22562265, 33099913, 33754027, 8880099, 9514061
Carcinoma Ovarian Epithelial	Stimulate	31312656
Carcinoma Renal Cell	Associate	17607380, 21068256, 25973014, 31850854, 35449452, 36353618, 7622256, 7905278, 7913877, 8099898, 9620222
Carcinoma Renal Cell	Stimulate	26943029
Carcinoma Squamous Cell	Inhibit	16412062
Cardiomyopathies	Associate	36936778, 8563121
Cardiomyopathy Dilated	Associate	11823084
Cardiovascular Diseases	Associate	20191078, 22808171, 24083591, 25575156, 25784313, 30653588, 31629408, 33050491, 36012132
Cardiovascular Diseases	Stimulate	27527002
Carotid Artery Diseases	Associate	27090396
Carotid Stenosis	Associate	25441669
Carrington syndrome	Associate	8980959
Cartilage Diseases	Associate	15380042
Cataract	Associate	22763828, 37131205
CD59 Deficiency	Associate	18045485, 18178826
Central Nervous System Diseases	Associate	1972610, 27406562
Cerebral Hemorrhage	Associate	35833818
Cerebral Infarction	Associate	17089918, 20360547, 20622166, 31183363
Cerebrovascular Disorders	Associate	10892347
Chemical and Drug Induced Liver Injury	Associate	1347281, 25675203
Chemical and Drug Induced Liver Injury	Stimulate	35473775
Chickenpox	Inhibit	17855547
Chlamydial Pneumonia	Stimulate	32601108
Cholangitis Sclerosing	Associate	7537707
Chondrosarcoma	Associate	12587980
Chorioamnionitis	Stimulate	39731491
Chronic Disease	Associate	1430258, 15711569
Chronic Disease	Inhibit	33246119
Chronic Periodontitis	Associate	22230463, 27391418, 7525481
Chronic Urticaria	Associate	38045687
Colitis	Associate	12477764
Colitis Ulcerative	Stimulate	11923606, 23717571
Colitis Ulcerative	Associate	12477764, 36860851, 38065859, 7902311
Colonic Neoplasms	Associate	11169447, 11761438, 7902311
Colorectal Neoplasms	Associate	15053044, 15334673, 16920698, 16937502, 18084316, 18084318, 19822019, 23098564, 24720439, 25532000, 27764803, 28105922, 28816939, 29105339, 29188362 View all (10 more)
Common Variable Immunodeficiency	Stimulate	1395097
Condylomata Acuminata	Associate	7908483
Congenital disorder of glycosylation type 1A	Associate	27415628
Congenital Hereditary and Neonatal Diseases and Abnormalities	Associate	9137107
Congenital Hypothyroidism	Associate	8099855
Conjunctivitis Acute Hemorrhagic	Associate	29284752
Conjunctivitis Allergic	Stimulate	9497473
Connective Tissue Diseases	Associate	10209523
Corneal Neovascularization	Associate	19531249
Coronary Aneurysm	Associate	31783796
Coronary Artery Disease	Stimulate	14695458, 20628522, 25890092
Coronary Artery Disease	Associate	17263916, 18057581, 19876414, 21169918, 22780915, 25310099, 26078712, 30961613, 31783796, 36928188, 8969030
Coronary Disease	Associate	18057581, 20940515, 22388798, 31072912, 32770617, 34850451, 34861059, 34873417, 39344313
Coronary Disease	Stimulate	28796044
Coronary Restenosis	Associate	21169918
Coronary Stenosis	Stimulate	10732847
Coronary Stenosis	Associate	14695458, 25310099
COVID 19	Associate	32582936, 32805728, 33260035, 33317616, 34176789, 34253708, 34450402, 34504502, 34836309, 34975885, 35174669, 35718334, 35855804, 36116160, 36139476
COVID 19	Stimulate	34804033
COVID 19	Inhibit	35033854, 35239653
Crohn Disease	Stimulate	11923606, 23717571, 7541009
Crohn Disease	Associate	12477764, 15958080, 18647548, 28400196, 7902311, 8537050
Crohn Disease	Inhibit	7900941
Cryptogenic Organizing Pneumonia	Stimulate	11512562
Cystic Fibrosis	Stimulate	17328035, 26185364
Cytokine Release Syndrome	Inhibit	35040554
Death	Associate	25422398
Death	Inhibit	35239653
Death Sudden	Associate	31783796
Death Sudden Cardiac	Associate	19221653
Dengue	Associate	31778418
Dermatitis	Stimulate	10086854
Dermatitis	Associate	7616001
Dermatitis Allergic Contact	Associate	2574536, 9155652
Dermatitis Atopic	Associate	15370698, 9160089
Dermatitis Contact	Associate	10504443, 1706746
Dermatitis Toxicodendron	Associate	2574536
Dermatomyositis	Stimulate	8800304, 9099932
Diabetes Complications	Associate	10540181
Diabetes Gestational	Associate	35046894
Diabetes Mellitus	Associate	1385478, 15031178, 16978373, 18604267, 21533024, 25287126, 28920516, 7545873
Diabetes Mellitus Type 1	Associate	10540181, 1675200, 16978373, 18505543, 19995711, 2498883
Diabetes Mellitus Type 2	Stimulate	22763828, 31629408
Diabetes Mellitus Type 2	Associate	27090396, 32176024, 34991588
Diabetic Foot	Associate	32176024
Diabetic Nephropathies	Associate	16978373, 18505543, 33506255, 36949528
Diabetic Retinopathy	Associate	19531249, 34010297
Dilatation Pathologic	Associate	10974034
Disease	Associate	1979938
Disorders of Sex Development	Associate	33422029
Down Syndrome	Associate	11678899, 27293319
Drug Eruptions	Associate	7915886
Drug Hypersensitivity	Stimulate	16433208, 7542574
Drug Hypersensitivity	Associate	23439564, 33122732, 7691450, 8102141
Drug Related Side Effects and Adverse Reactions	Associate	10780664, 11877286, 1713198, 25124788, 25860927, 8093857
Drug Related Side Effects and Adverse Reactions	Inhibit	35418483
Edema	Associate	2574536, 8609251
Emphysema	Associate	25306249
Encephalitis	Associate	37644514
Encephalitis Viral	Associate	1972610
Endometriosis	Associate	11937115, 14505752, 16759923, 27614631, 35616875, 9848307
Endometriosis	Stimulate	34920657
Eosinophilia	Associate	7525343
Eosinophilic Esophagitis	Associate	20191078
Eosinophilic Esophagitis	Stimulate	21921589
Eosinophilic Esophagitis	Inhibit	31983676
Epilepsy Familial Mesial Temporal Lobe	Associate	22535415
Epileptic Syndromes	Associate	15547024
Epiretinal Membrane	Associate	7517695
Epstein Barr Virus Infections	Associate	11168811, 1316791
Erythema	Associate	2574536
Erythema Multiforme	Associate	7616001
Esophageal Neoplasms	Associate	37966470
Esophageal Squamous Cell Carcinoma	Associate	7665697
Essential Hypertension	Associate	16382212, 25897102
Eye Infections Fungal	Associate	12808331
Fibrosis	Associate	11512562, 18256065, 35473775
Frailty	Associate	27310835
Fuchs' Endothelial Dystrophy	Associate	18603066, 35351411
Gastrointestinal Diseases	Associate	10736107
Gastroschisis	Associate	27616475
Genital Neoplasms Female	Associate	25880896
Gerodermia osteodysplastica	Associate	32735324
Giant Cell Arteritis	Associate	10643715
Giant Cell Arteritis	Stimulate	1712368
Glaucoma Angle Closure	Associate	37131205
Glioblastoma	Associate	1974176, 22591734, 30959276
Glioblastoma	Stimulate	24252689
Glioma	Associate	24289603, 26473373, 7506810, 7526247, 7537727, 7915264
Glomerulonephritis	Associate	10027408, 1381006, 1430258
Glomerulonephritis IGA	Stimulate	30547763
Glomerulonephritis IGA	Associate	35688937
Glomerulonephritis Membranous	Associate	35172688, 9551397
Glomerulosclerosis Focal Segmental	Associate	1381006
Glucosephosphate Dehydrogenase Deficiency	Associate	18031538, 23098466
Glucosephosphate Dehydrogenase Deficiency	Stimulate	33050491
Glycosuria Renal	Associate	35688937
Graft vs Host Disease	Associate	1370927, 21430507, 22796533, 27086024
Graft vs Host Disease	Stimulate	31300420
Granuloma	Stimulate	26368286
Granulomatosis with Polyangiitis	Associate	27624647
Granulomatous Disease Chronic	Associate	14688376, 1712368
Graves Disease	Associate	1378365, 25617714, 7902787
Graves Disease	Stimulate	7626551
Graves Ophthalmopathy	Stimulate	19419934, 39234250
Graves Ophthalmopathy	Associate	24562464, 7680294, 9158103
Guillain Barre Syndrome	Associate	22552879, 31464097, 34763483
HAIR AN syndrome	Associate	9133990
Hand Arm Vibration Syndrome	Stimulate	38302542
Hand Foot and Mouth Disease	Inhibit	24367714
Hashimoto Disease	Associate	1671565
Hashimoto Disease	Inhibit	35871446
Hashimoto Disease	Stimulate	7626551
Hearing Loss Sensorineural	Associate	29695657
Heart Failure	Associate	31275451, 35775773
Heart Valve Diseases	Associate	28623907
Hemangioma Cavernous Central Nervous System	Associate	24430173
Hemangiosarcoma	Associate	22664113
Hemolysis	Associate	32777069
Hemolytic Uremic Syndrome	Stimulate	30481789
Hemolytic Uremic Syndrome	Associate	32635212
Hemorrhage	Stimulate	34326842
Hemorrhagic Fever with Renal Syndrome	Associate	10461425
Hepatitis Alcoholic	Associate	1347281, 33954832
Hepatitis B Chronic	Stimulate	1360668
Hepatitis B Chronic	Associate	7706478
Hepatitis C Chronic	Stimulate	7737571
Hereditary leiomyomatosis and renal cell cancer	Associate	21435201
Hirschsprung Disease	Associate	36248794
Histiocytosis Langerhans Cell	Associate	7510455, 7573361
HIV Infections	Associate	10403921, 32161179
HIV Infections	Stimulate	12773706, 9272912
HIV Seropositivity	Associate	22024147
Hodgkin Disease	Associate	1605306, 9722296
HTLV II Infections	Associate	7545080
Humoral Hypercalcemia Of Malignancy	Associate	8781429
Huntington Disease	Associate	1605306
Hypercholesterolemia	Associate	35282277
Hyperglycemia	Stimulate	20592773
Hyperkeratosis lenticularis perstans	Stimulate	27787379
Hyperlipoproteinemia Type II	Stimulate	16549444
Hypersensitivity	Associate	8102141
Hypersensitivity Delayed	Stimulate	1705751
Hypersensitivity Delayed	Associate	2571643
Hypertension	Associate	24083591, 26004608, 26078712, 26391130
Hypertension Pregnancy Induced	Stimulate	12648441
Hypothermia	Associate	23337791
Hypoxia	Stimulate	25879517, 27858190, 37071849
Hypoxia	Associate	29743093
Hypoxia Brain	Associate	35438581
Idiopathic Interstitial Pneumonias	Associate	11512562
Idiopathic Pulmonary Fibrosis	Stimulate	11512562
Idiopathic Pulmonary Fibrosis	Associate	1352747, 7904545
IgA Vasculitis	Associate	25760949, 9014604
Immune System Diseases	Associate	15756053
Infant Premature Diseases	Associate	36788602
Infarction	Stimulate	10898423
Infarction	Associate	1972610
Infections	Stimulate	10024555, 10092659, 10710529, 11953375, 21621633, 36366528
Infections	Associate	10208936, 10931151, 11292691, 11350790, 11665982, 11920508, 22585227, 25404022, 31315993, 7545080, 9137107, 9762790, 9765484
Inflammation	Associate	10092659, 10225979, 10447928, 10453751, 10660687, 10693873, 10710529, 10931151, 11034993, 11121127, 11450703, 11923606, 12044887, 12142120, 12808331 View all (156 more)
Inflammation	Stimulate	10732847, 19277231, 20347403, 22248682, 23049757, 24005865, 24600034, 26185364, 26345838, 29517712, 30214039, 31316519, 31739614, 34601427, 34685528 View all (5 more)
Inflammatory Bowel Diseases	Associate	11923606, 12477764, 18647548, 23717571
Inflammatory Bowel Diseases	Stimulate	17610002, 34561227, 36361571
Influenza Human	Stimulate	16914605
Insulin Resistance	Associate	31629408
Intervertebral Disc Degeneration	Stimulate	27018499
Intracranial Aneurysm	Associate	26345838
Invasive Pulmonary Aspergillosis	Stimulate	22731696
Iron Overload	Stimulate	25500022
Irritable Bowel Syndrome	Associate	10562584
Ischemia	Inhibit	17511040
Ischemic Stroke	Associate	32815572, 33458871, 35441431
Ischemic Stroke	Stimulate	39394477
Job Syndrome	Associate	15250469
Job Syndrome	Inhibit	39229272
Juvenile gout	Associate	29657028
Kidney Diseases	Associate	1430258, 38174742
Kidney Failure Chronic	Associate	10231462, 33574979
Laryngeal Neoplasms	Associate	38376278
Lead Poisoning Nervous System	Associate	38146363
Leishmaniasis Cutaneous	Associate	21905501
Leprosy	Stimulate	9472661
Leprosy Borderline	Stimulate	9472661
Leprosy Lepromatous	Stimulate	9472661
Leukemia	Associate	11877286, 1370201, 1671649, 28807569
Leukemia	Stimulate	15699173, 28216566
Leukemia B Cell	Associate	2673591, 8102559
Leukemia Biphenotypic Acute	Associate	32466311
Leukemia Biphenotypic Acute	Stimulate	9029017
Leukemia Hairy Cell	Associate	1352710
Leukemia Lymphocytic Chronic B Cell	Associate	10068672, 12377186, 16081691, 16113842, 16517754, 19009294, 19828693, 20122733
Leukemia Lymphocytic Chronic B Cell	Inhibit	1974471
Leukemia Lymphocytic Chronic B Cell	Stimulate	34879826, 7949173
Leukemia Lymphoma Adult T Cell	Associate	10607681, 11920508, 18702873, 31315993, 7662973, 8920885, 9219058
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	15674360, 1974471, 26722450
Leukemia Myelogenous Chronic BCR ABL Positive	Stimulate	23180012
Leukemia Myeloid	Associate	1974471
Leukemia Myeloid Acute	Associate	10706072, 11090069, 1708296, 1974471, 25795133, 26246143, 29720577, 9058727
Leukemia Plasma Cell	Associate	21526505, 26130131, 8797890
Leukemia Promyelocytic Acute	Associate	33422029
Leukemia T Cell	Associate	10210778, 1370201
Lichen Planus	Associate	7616001
Lichen Planus Oral	Associate	19680199
Liposarcoma	Stimulate	11278855
Liver Cirrhosis	Associate	35473775
Liver Cirrhosis Biliary	Associate	14606706, 16038038, 7537707, 8104850
Liver Diseases	Inhibit	25242329
Liver Diseases	Associate	7904546
Liver Diseases Alcoholic	Stimulate	33954832
Lung Diseases	Associate	18446055, 9620222
Lung Diseases Interstitial	Stimulate	10607488
Lung Diseases Interstitial	Associate	11512562, 19644880, 20360623
Lung Neoplasms	Associate	14509560, 15053044, 1680858, 22248682, 22266541, 26513172, 36688994, 7829125, 8880099, 9058094, 9620222
Lupus Erythematosus Cutaneous	Associate	7616001
Lupus Erythematosus Systemic	Associate	10598755, 1974276, 27847409, 7521807
Lupus Erythematosus Systemic	Stimulate	11406523, 24083390, 28153882
Lupus Erythematosus Systemic	Inhibit	35332100
Lupus Nephritis	Associate	11737595
Lupus Nephritis	Inhibit	30537116
Lyme Disease	Associate	11179355
Lymphatic Metastasis	Stimulate	24548863, 25450269, 26109813
Lymphohistiocytosis Hemophagocytic	Associate	32356861
Lymphoma	Associate	1373268, 1384339, 21435201, 34503477
Lymphoma B Cell	Associate	1381563, 1974471, 34879826, 7742541
Lymphoma B Cell	Stimulate	17053842, 31254446
Lymphoma B Cell Marginal Zone	Stimulate	34879826
Lymphoma Follicular	Associate	34879826, 7682455
Lymphoma Large B Cell Diffuse	Associate	33288735, 34503477
Lymphoma Mantle Cell	Stimulate	34879826
Lymphoma Non Hodgkin	Associate	25948491
Lymphoma Primary Effusion	Associate	33411730
Lymphoma T Cell	Associate	23583640
Lymphopenia	Associate	8547669
Lymphoproliferative Disorders	Associate	1974471, 38065859
Malaria	Associate	18604267, 20712868, 21533024, 22909232, 31138740, 33203751
Malaria Cerebral	Associate	16705810, 24386348, 25156105, 27406562, 30610112, 31308082, 35379236, 35417070
Malnutrition	Stimulate	31398886
Mast Cell Activation Disorders	Associate	7524750
Mastitis	Associate	35331909
Measles	Associate	17538120
Melanoma	Associate	10382738, 10408388, 10414467, 1347555, 1370233, 15132836, 17649820, 21487066, 23284620, 26338962, 2643120, 28341549, 30116025, 35295096, 7627996 View all (6 more)
Melanoma	Stimulate	23039186, 25138157, 35538545, 8440919
Memory Disorders	Associate	15711569
Meningioma	Associate	25178329
Mental Disorders	Associate	34911938, 35063598
Mesothelioma Malignant	Associate	10232421
Metabolic Syndrome	Associate	17112530, 18761738
Microscopic Polyangiitis	Associate	36726727
Mitral Valve Insufficiency	Associate	34139044
Mouth Diseases	Associate	1372348, 36906717
Mouth Neoplasms	Associate	20647315, 24069166
Mucocele	Associate	19429776
Mucocutaneous Lymph Node Syndrome	Associate	28069066
Multiple Myeloma	Associate	10848782, 12135668, 12139739, 15287939, 17177159, 25341809, 28154173, 30736330, 32526706, 39503766, 8103718, 8797890, 8830734, 9649209
Multiple Organ Failure	Associate	34504502
Multiple Sclerosis	Associate	12745437, 1972610, 24430173
Multiple Sclerosis Relapsing Remitting	Associate	23611040
Multiple Sclerosis Relapsing Remitting	Stimulate	32386505
Muscular Diseases	Associate	15608947, 9099932
Muscular dystrophy congenital with central nervous system involvement	Inhibit	9029017
Mycosis Fungoides	Associate	1281618
Myelodysplastic Syndromes	Inhibit	10606893
Myelodysplastic Syndromes	Associate	1974471, 20562331, 36503307
Myeloproliferative Disorder Chronic with Eosinophilia	Stimulate	8969030
Myocardial Infarction	Stimulate	10475771
Myocardial Infarction	Associate	15067196, 16820586, 18057581, 18604267, 20191078, 21533024, 23493781, 31739782, 9426029
Myocardial Ischemia	Associate	10898423, 21808112
Myocarditis	Associate	26945075, 35549587
Myositis	Associate	19353432, 19644880, 7507012, 9099932
Myotonic Dystrophy	Stimulate	22763828
Mysophobia	Associate	7525481
Nasal Polyps	Associate	10931151, 18629784, 25573100
Nasal Polyps	Stimulate	39191825
Nasopharyngeal Carcinoma	Associate	18087217, 34544905
Necrobiotic Xanthogranuloma	Associate	24428816
Necrosis	Stimulate	1360668
Necrosis	Associate	38065859
Neonatal hemochromatosis	Associate	7519822
Neoplasm Invasiveness	Associate	26341495
Neoplasm Metastasis	Stimulate	1347555, 15334673
Neoplasm Metastasis	Associate	16773720, 16780590, 21590495, 21820422, 22294843, 23803661, 24548863, 24789429, 25138157, 25450269, 25973014, 26109813, 26341495, 2643120, 27764803 View all (10 more)
Neoplasm Residual	Associate	27682210
Neoplasms	Associate	10362102, 10408388, 10632979, 10892347, 10938387, 11034993, 11200836, 11245598, 11761443, 11828261, 1311218, 1370201, 16237071, 16920698, 17166398 View all (86 more)
Neoplasms	Inhibit	11122109, 11720474, 17977648, 8695814, 9328140
Neoplasms	Stimulate	18446055, 21487066, 25879517, 25880896, 29188362
Neoplasms Adipose Tissue	Associate	32655010
Neoplasms Basal Cell	Associate	8100398
Neoplasms Glandular and Epithelial	Associate	8102029
Nervous System Diseases	Associate	30214039
Netherton Syndrome	Associate	7742541
Neu Laxova syndrome	Associate	36216277
Neuralgia	Stimulate	37446303
Neuroblastoma	Associate	8494726
Neurodegenerative Diseases	Associate	25197660
Neurofibrosarcoma	Associate	34079083
Neurologic Manifestations	Stimulate	34450402
Neuromyelitis Optica	Stimulate	28946890
Nevus Pigmented	Stimulate	11121127
Nevus Pigmented	Associate	1974278, 2645372, 9077486
Niemann Pick Disease Type A	Associate	37341882
Niemann Pick Disease Type C	Associate	24367666
Nose Diseases	Associate	25573100
Obesity	Stimulate	19249917, 21481180, 30572569
Oral Ulcer	Associate	37653793
Osteoarthritis	Associate	14609532, 15934126, 24667577, 31146598, 31812161, 39379962
Osteoarthritis	Stimulate	15731292, 32384383
Osteoarthritis Knee	Inhibit	36216277
Osteoarthritis Knee	Associate	39379962
Osteomyelitis	Associate	35711689
Osteoporosis	Associate	11028443
Osteosarcoma	Associate	10849374, 9109391
Ovarian Neoplasms	Inhibit	11720474, 25659662
Ovarian Neoplasms	Associate	14715418, 25659662, 25879517, 31312656, 35449452, 36854451
Ovarian Neoplasms	Stimulate	37644468
Pain	Associate	27682210
Pancreatic Neoplasms	Associate	15053044, 21443201, 22335271, 32135474, 8093857
Pancreatitis Chronic	Associate	15917409, 21443201
Paraparesis Tropical Spastic	Associate	10225829
Parasitic Diseases	Associate	36936778
Peri Implantitis	Associate	36013591
Periodontitis	Associate	15618163, 27391418
Periodontitis	Stimulate	34213019
Peripheral Arterial Occlusive Disease 1	Associate	17598820, 20191078
Peripheral Vascular Diseases	Associate	25287126
Periprosthetic Fractures	Associate	35306116
Peritonitis	Associate	18350449
Personality Disorders	Associate	25178329
Pigmentary Disorder Reticulate with Systemic Manifestations	Associate	7517695
Pituitary Neoplasms	Associate	33203795
Plaque Atherosclerotic	Associate	1372160, 19876414
Pleural Effusion	Associate	24069325
Pneumococcal Infections	Associate	12952922
Pneumonia	Associate	10445615
POEMS Syndrome	Associate	1974471
Polycystic Ovary Syndrome	Associate	27039809, 31629408, 36793022
Polymyositis	Associate	19644880
Pre Eclampsia	Associate	12623476, 15954879
Pre Eclampsia	Stimulate	27604418
Precancerous Conditions	Stimulate	35473775
Precursor Cell Lymphoblastic Leukemia Lymphoma	Inhibit	1974471
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	9029017
Premature Birth	Associate	36788602
Prostatic Neoplasms	Associate	23559257, 23803661, 24151226, 26265203, 26537072, 30577600, 33569050
Prostatitis	Associate	23559257
Protein Energy Malnutrition	Associate	38017491
Psoriasis	Associate	8721479
Pterygium	Associate	36768371
Pulmonary Arterial Hypertension	Associate	18029384
Pulmonary Arterial Hypertension	Stimulate	20808962, 24083390
Pulmonary Disease Chronic Obstructive	Associate	14624669, 16611655, 16907910, 20395558, 23635004, 33260035, 40161396
Pulmonary Disease Chronic Obstructive	Stimulate	28056984
Pulmonary Embolism	Associate	22267767
Pulmonary Fibrosis	Associate	7905208
Pulpitis	Associate	15618163, 33046027
Purpura Thrombocytopenic Idiopathic	Associate	34326842
Radicular Cyst	Associate	27918735
Raynaud Disease	Stimulate	38302542
Recurrent respiratory papillomatosis	Stimulate	36154611
Renal Insufficiency Chronic	Associate	31924810, 36860851, 38017491, 38174742
Reperfusion Injury	Stimulate	12829075
Reperfusion Injury	Associate	20348235, 39341981
Respiratory Distress Syndrome	Associate	33608030
Respiratory Hypersensitivity	Associate	7525343
Reticulocytosis	Associate	32777069
Retinal Diseases	Associate	25675437, 27380422, 29743093
Retinal Vein Occlusion	Stimulate	35370941
Rhabdomyosarcoma	Associate	21262518
Rheumatic Diseases	Inhibit	31861245
Rheumatoid Nodule	Associate	9797554
Rheumatoid Vasculitis	Associate	9059140
Rhinitis Allergic	Associate	23472126
Sarcoidosis	Stimulate	11817671
Sarcoidosis	Associate	19077082, 26368286, 7904545, 9797497
Sarcoidosis Pulmonary	Associate	11817671, 7904545, 7905208
Sarcoma	Associate	24584817
Sarcoma Ewing	Associate	18212050, 33104883, 34831294
Sarcoma Kaposi	Associate	17047149
Schizophrenia	Associate	15756053, 30214039, 36182530
Scleroderma Systemic	Associate	18029384, 23685129
Scleroderma Systemic	Stimulate	24083390, 30157947
Scrub Typhus	Stimulate	34368012
Severe Acute Respiratory Syndrome	Associate	36182530
Severe Dengue	Associate	31778418
Sick Sinus Syndrome	Associate	10403921
Sjogren's Syndrome	Associate	11359451, 36768371
Skin Diseases	Associate	12808331, 2469738, 7539468, 7706764, 7738361, 7798616
Skin Diseases	Stimulate	30842373
Skin Neoplasms	Associate	7798616, 9192652
Skin Ulcer	Associate	10086854
Sleep Apnea Obstructive	Stimulate	27693879
Small Cell Lung Carcinoma	Associate	8880099
smoker's inclusion bodies	Associate	26341495
Smoldering Multiple Myeloma	Inhibit	26668134
Soft Tissue Injuries	Associate	1347281
Spasm	Associate	10732847
Spinal Injuries	Associate	37446303
Splenomegaly	Associate	9029017
Squamous Cell Carcinoma of Head and Neck	Associate	24069166, 24205072, 24398980, 32121422, 35211756, 37082943
Squamous Cell Carcinoma of Head and Neck	Stimulate	25450269
Squamous Cell Carcinoma of Head and Neck	Inhibit	9328140
Starvation	Stimulate	25879517, 35449452
Status Asthmaticus	Stimulate	29985427
Status Asthmaticus	Associate	7525343, 7691450, 7908615, 7962529
Stenosis Pulmonary Vein	Stimulate	26109813
Still's Disease Adult Onset	Associate	15934126
Stomach Diseases	Associate	35473775
Stomach Neoplasms	Associate	10722567, 16773720, 17708604, 22294843, 22408359, 24548863, 25441488, 29917191, 32373959, 9529982, 9683305
Stroke	Associate	18604267, 20191078, 21533024
Stroke	Stimulate	39394477
Syndrome	Stimulate	10192453
Synovitis	Associate	11014344, 15934126
Systemic Inflammatory Response Syndrome	Associate	39731491
Tachycardia	Associate	35282277
Tachycardia Atrioventricular Nodal Reentry	Associate	16780590
Tertiary Lymphoid Structures	Associate	10607681
Tertiary Lymphoid Structures	Stimulate	21590495
Tetany	Associate	27889981
Thrombocytopenia 1	Associate	20130240
Thrombosis	Associate	17677000, 25988387
Thrombosis	Stimulate	26109813
Thymoma	Associate	10886240
Thyroid Cancer Papillary	Associate	15331401, 30414611, 35871446
Thyroid Neoplasms	Associate	36906717
Thyroid Nodule	Associate	36906717
Thyroiditis Autoimmune	Associate	7902787
Trichothiodystrophy Syndromes	Stimulate	9192652
Triple Negative Breast Neoplasms	Associate	30082828, 37671167
Triple Negative Breast Neoplasms	Stimulate	36373309, 36444196
Tuberculosis	Associate	15373915, 16313368, 26368286
Tuberculosis Meningeal	Inhibit	12562391
Tuberculosis Multidrug Resistant	Associate	28816939
Tuberculosis Pleural	Associate	19714575
Tuberculosis Pulmonary	Associate	33099324
Ulcer	Associate	12808331
Urinary Bladder Neoplasms	Associate	12357319, 1353063, 15053044, 16780590, 19913990, 24857933, 28355551, 29966014
Uterine Cervical Dysplasia	Associate	10209502, 8102029
Uterine Cervicitis	Associate	40352921
Uveitis	Associate	20445114, 23401649, 9640196
Uveitis Posterior	Associate	27293321
Varicose Ulcer	Stimulate	27994710
Vascular Diseases	Associate	10722838, 12142120, 23401649, 25323856, 25489974, 26761204, 27884380, 30572569, 30871567, 31782253, 35245485, 38195507, 39182041, 40187599
Vascular Diseases	Stimulate	32382091, 33954832, 9152314
Vascular Ring	Associate	35712246
Vascular System Injuries	Associate	12714608, 24566270
Vasculitis	Associate	10027408, 11406523, 12808331, 9158091
Vasculitis Central Nervous System	Stimulate	9158091
Vasculitis Leukocytoclastic Cutaneous	Associate	7561155
Venous Insufficiency	Associate	10086854
Venous Thromboembolism	Stimulate	24339944
Venous Thromboembolism	Associate	35711689
Vitiligo	Associate	11121127, 23777204, 24312346
Vulvar Diseases	Associate	7908483
Xanthomatosis	Associate	24428816
Xeroderma Pigmentosum Complementation Group D	Stimulate	9192652

ICAM1 (intercellular adhesion molecule 1)